Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3D9C2

Protein Details
Accession A0A0C3D9C2    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-45SLPGSSPSKSRPQPRLKKIRPVRRRGRGRHDFESDEBasic
105-124RHTGPRASTKPKNQDPPSFFHydrophilic
159-185QPAVKAPPPRKAPKSSRRPQVKRAVSAHydrophilic
NLS Segment(s)
PositionSequence
17-38SKSRPQPRLKKIRPVRRRGRGR
163-181KAPPPRKAPKSSRRPQVKR
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR018545  Btz_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0035145  C:exon-exon junction complex  
GO:0003729  F:mRNA binding  
GO:0006397  P:mRNA processing  
GO:0051028  P:mRNA transport  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
GO:0006417  P:regulation of translation  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF09405  Btz  
Amino Acid Sequences MPATTTTPSSLPGSSPSKSRPQPRLKKIRPVRRRGRGRHDFESDEEIVREVGTDSELDNDDHSSVGSTTDSDTEPVSEDVSSNGRQSRILTPNTTQSSADVRSLRHTGPRASTKPKNQDPPSFFEGGNWSEMVADEAANGPSDLPVVDFADFGTSSLDQPAVKAPPPRKAPKSSRRPQVKRAVSAPTVDRPPAPQPSPPAQTDLDMEDPTDGQQPISTPNQPPRSNIERRLGQSARQAYQQRLESDPSFVPTVGEFWGHDDRLLDKNLRSLSGWWRGRWQGRGRGRGVDRMFMRGRGRGPVAGSDSGHRGSAEGDSDPQEAQKPPTEVPRVDQPWTHDGYEEMKKRDERRREAQQQQAPRGAQGFGPRGRGASITPRGRGGLARGGGFTSSPTRPAFVPPVSTPDRTWYAMKPERVWTKQHDAFLYFDFALKPRAGVGPGYRVKLPNAQAHIVRGPVRRSHPSTAEVASSSQAPPSEDGDKLFVVRLPKRSGKEKAKESTLPPSEPLTTVEELPIDDAFVVRPELAPPRILIVDTKSPAISTPETSLPSGPSHSLPQPIPPPAPASTEVVKASSQPAVVDPQPSQSAAPSADAAPSALQDSEVSPSREKSQTTETQEAPVRRNVPPVPPPLQTVFPPPQPSPPYSSHYSYASPLPPGVAVNQHGMAYEVATGRPVYLPPVYTPRPLSHGMMTPPGMSYMPGHMHHHSSSPDFLAPPHTPPIAGFVDPSTGGPLFTFPRQNARVEIRAPSSTLDLKSVKPQRRPSSLRTSAATYEPSQPEPLGNGMTPFPSSSPSDSYVIQSGLDALDSTNTGTPPGQQPADPAMLGYSAYPAPYYYPEQYGYTQYYDVSHVPQYEMYHADPHHPSQGVVYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.35
4 0.42
5 0.5
6 0.58
7 0.62
8 0.68
9 0.77
10 0.83
11 0.89
12 0.88
13 0.91
14 0.92
15 0.92
16 0.92
17 0.92
18 0.92
19 0.91
20 0.94
21 0.93
22 0.93
23 0.93
24 0.9
25 0.87
26 0.83
27 0.76
28 0.68
29 0.65
30 0.56
31 0.47
32 0.39
33 0.32
34 0.25
35 0.21
36 0.18
37 0.11
38 0.09
39 0.08
40 0.08
41 0.08
42 0.11
43 0.13
44 0.13
45 0.13
46 0.14
47 0.13
48 0.13
49 0.13
50 0.11
51 0.09
52 0.1
53 0.09
54 0.09
55 0.1
56 0.12
57 0.13
58 0.12
59 0.13
60 0.12
61 0.14
62 0.14
63 0.14
64 0.12
65 0.11
66 0.13
67 0.16
68 0.17
69 0.18
70 0.21
71 0.21
72 0.22
73 0.25
74 0.32
75 0.35
76 0.38
77 0.39
78 0.39
79 0.47
80 0.51
81 0.49
82 0.4
83 0.35
84 0.36
85 0.34
86 0.36
87 0.3
88 0.27
89 0.3
90 0.34
91 0.33
92 0.35
93 0.37
94 0.36
95 0.42
96 0.5
97 0.52
98 0.57
99 0.64
100 0.67
101 0.74
102 0.78
103 0.8
104 0.78
105 0.81
106 0.77
107 0.75
108 0.7
109 0.63
110 0.54
111 0.45
112 0.43
113 0.34
114 0.31
115 0.23
116 0.18
117 0.15
118 0.15
119 0.14
120 0.1
121 0.08
122 0.06
123 0.08
124 0.08
125 0.09
126 0.09
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.07
133 0.08
134 0.08
135 0.08
136 0.08
137 0.1
138 0.1
139 0.1
140 0.1
141 0.1
142 0.1
143 0.11
144 0.12
145 0.1
146 0.11
147 0.15
148 0.16
149 0.19
150 0.26
151 0.29
152 0.36
153 0.45
154 0.53
155 0.56
156 0.63
157 0.71
158 0.74
159 0.81
160 0.82
161 0.84
162 0.86
163 0.86
164 0.86
165 0.86
166 0.83
167 0.78
168 0.73
169 0.7
170 0.6
171 0.57
172 0.51
173 0.46
174 0.41
175 0.36
176 0.32
177 0.28
178 0.32
179 0.36
180 0.34
181 0.32
182 0.35
183 0.41
184 0.45
185 0.43
186 0.41
187 0.34
188 0.33
189 0.32
190 0.28
191 0.24
192 0.19
193 0.18
194 0.15
195 0.14
196 0.14
197 0.16
198 0.13
199 0.1
200 0.11
201 0.12
202 0.15
203 0.19
204 0.22
205 0.23
206 0.31
207 0.41
208 0.41
209 0.43
210 0.47
211 0.52
212 0.55
213 0.57
214 0.57
215 0.54
216 0.55
217 0.61
218 0.55
219 0.49
220 0.5
221 0.49
222 0.42
223 0.43
224 0.44
225 0.37
226 0.43
227 0.43
228 0.38
229 0.35
230 0.37
231 0.31
232 0.32
233 0.29
234 0.26
235 0.22
236 0.19
237 0.17
238 0.13
239 0.14
240 0.1
241 0.1
242 0.08
243 0.12
244 0.15
245 0.15
246 0.15
247 0.14
248 0.17
249 0.2
250 0.22
251 0.2
252 0.17
253 0.22
254 0.22
255 0.23
256 0.21
257 0.2
258 0.25
259 0.33
260 0.35
261 0.31
262 0.36
263 0.41
264 0.44
265 0.49
266 0.49
267 0.49
268 0.54
269 0.61
270 0.57
271 0.59
272 0.57
273 0.57
274 0.51
275 0.48
276 0.4
277 0.39
278 0.38
279 0.35
280 0.35
281 0.3
282 0.3
283 0.28
284 0.28
285 0.24
286 0.23
287 0.22
288 0.23
289 0.21
290 0.2
291 0.18
292 0.19
293 0.18
294 0.17
295 0.14
296 0.11
297 0.1
298 0.11
299 0.1
300 0.08
301 0.09
302 0.11
303 0.12
304 0.12
305 0.11
306 0.13
307 0.13
308 0.15
309 0.18
310 0.18
311 0.18
312 0.26
313 0.29
314 0.27
315 0.29
316 0.36
317 0.34
318 0.34
319 0.34
320 0.31
321 0.31
322 0.33
323 0.31
324 0.22
325 0.2
326 0.23
327 0.29
328 0.3
329 0.27
330 0.29
331 0.33
332 0.4
333 0.48
334 0.53
335 0.53
336 0.57
337 0.65
338 0.71
339 0.75
340 0.77
341 0.74
342 0.71
343 0.68
344 0.64
345 0.54
346 0.45
347 0.38
348 0.29
349 0.24
350 0.22
351 0.23
352 0.2
353 0.23
354 0.22
355 0.21
356 0.21
357 0.2
358 0.16
359 0.19
360 0.25
361 0.25
362 0.26
363 0.26
364 0.26
365 0.26
366 0.26
367 0.2
368 0.17
369 0.15
370 0.15
371 0.14
372 0.14
373 0.13
374 0.13
375 0.12
376 0.1
377 0.09
378 0.12
379 0.12
380 0.13
381 0.13
382 0.16
383 0.19
384 0.16
385 0.19
386 0.17
387 0.23
388 0.25
389 0.25
390 0.23
391 0.23
392 0.25
393 0.24
394 0.25
395 0.21
396 0.27
397 0.31
398 0.32
399 0.31
400 0.34
401 0.39
402 0.4
403 0.42
404 0.38
405 0.41
406 0.43
407 0.43
408 0.37
409 0.32
410 0.31
411 0.28
412 0.25
413 0.16
414 0.14
415 0.12
416 0.11
417 0.12
418 0.1
419 0.09
420 0.08
421 0.08
422 0.08
423 0.09
424 0.1
425 0.16
426 0.19
427 0.2
428 0.2
429 0.2
430 0.21
431 0.25
432 0.28
433 0.24
434 0.24
435 0.25
436 0.24
437 0.25
438 0.25
439 0.21
440 0.22
441 0.2
442 0.2
443 0.22
444 0.26
445 0.29
446 0.33
447 0.35
448 0.33
449 0.33
450 0.33
451 0.3
452 0.26
453 0.21
454 0.17
455 0.14
456 0.13
457 0.11
458 0.09
459 0.08
460 0.08
461 0.09
462 0.11
463 0.13
464 0.12
465 0.12
466 0.13
467 0.13
468 0.12
469 0.12
470 0.11
471 0.14
472 0.17
473 0.21
474 0.24
475 0.29
476 0.32
477 0.39
478 0.47
479 0.51
480 0.56
481 0.59
482 0.59
483 0.59
484 0.59
485 0.54
486 0.54
487 0.48
488 0.41
489 0.34
490 0.32
491 0.27
492 0.25
493 0.24
494 0.18
495 0.16
496 0.15
497 0.14
498 0.13
499 0.12
500 0.12
501 0.09
502 0.06
503 0.05
504 0.05
505 0.04
506 0.05
507 0.05
508 0.04
509 0.05
510 0.06
511 0.1
512 0.11
513 0.11
514 0.11
515 0.12
516 0.13
517 0.13
518 0.12
519 0.12
520 0.16
521 0.16
522 0.17
523 0.15
524 0.15
525 0.15
526 0.18
527 0.15
528 0.12
529 0.14
530 0.16
531 0.17
532 0.18
533 0.18
534 0.16
535 0.16
536 0.16
537 0.14
538 0.13
539 0.15
540 0.16
541 0.2
542 0.18
543 0.22
544 0.24
545 0.26
546 0.25
547 0.23
548 0.25
549 0.22
550 0.24
551 0.21
552 0.21
553 0.2
554 0.22
555 0.21
556 0.19
557 0.18
558 0.16
559 0.16
560 0.13
561 0.12
562 0.1
563 0.1
564 0.13
565 0.13
566 0.15
567 0.13
568 0.15
569 0.16
570 0.16
571 0.15
572 0.12
573 0.13
574 0.11
575 0.12
576 0.1
577 0.1
578 0.1
579 0.1
580 0.09
581 0.07
582 0.07
583 0.07
584 0.06
585 0.06
586 0.06
587 0.07
588 0.1
589 0.13
590 0.15
591 0.15
592 0.17
593 0.22
594 0.25
595 0.25
596 0.25
597 0.29
598 0.34
599 0.41
600 0.44
601 0.4
602 0.42
603 0.47
604 0.46
605 0.42
606 0.39
607 0.36
608 0.31
609 0.37
610 0.34
611 0.36
612 0.39
613 0.42
614 0.41
615 0.39
616 0.41
617 0.38
618 0.38
619 0.32
620 0.33
621 0.31
622 0.31
623 0.34
624 0.32
625 0.37
626 0.38
627 0.39
628 0.38
629 0.38
630 0.39
631 0.39
632 0.42
633 0.36
634 0.36
635 0.35
636 0.31
637 0.31
638 0.27
639 0.23
640 0.2
641 0.18
642 0.16
643 0.15
644 0.14
645 0.13
646 0.13
647 0.14
648 0.15
649 0.15
650 0.14
651 0.15
652 0.13
653 0.1
654 0.1
655 0.09
656 0.08
657 0.09
658 0.09
659 0.08
660 0.09
661 0.09
662 0.1
663 0.11
664 0.12
665 0.14
666 0.22
667 0.24
668 0.27
669 0.3
670 0.29
671 0.32
672 0.33
673 0.33
674 0.29
675 0.31
676 0.29
677 0.3
678 0.29
679 0.25
680 0.22
681 0.21
682 0.17
683 0.14
684 0.13
685 0.13
686 0.17
687 0.19
688 0.22
689 0.23
690 0.27
691 0.27
692 0.29
693 0.27
694 0.25
695 0.25
696 0.23
697 0.23
698 0.19
699 0.19
700 0.22
701 0.21
702 0.22
703 0.24
704 0.22
705 0.21
706 0.2
707 0.25
708 0.21
709 0.2
710 0.18
711 0.14
712 0.16
713 0.16
714 0.16
715 0.14
716 0.11
717 0.11
718 0.11
719 0.13
720 0.14
721 0.17
722 0.22
723 0.2
724 0.3
725 0.32
726 0.34
727 0.38
728 0.41
729 0.42
730 0.4
731 0.43
732 0.38
733 0.37
734 0.36
735 0.31
736 0.29
737 0.28
738 0.26
739 0.27
740 0.25
741 0.25
742 0.34
743 0.42
744 0.47
745 0.51
746 0.61
747 0.64
748 0.72
749 0.77
750 0.75
751 0.77
752 0.77
753 0.72
754 0.65
755 0.61
756 0.53
757 0.5
758 0.46
759 0.37
760 0.37
761 0.36
762 0.35
763 0.32
764 0.3
765 0.28
766 0.26
767 0.25
768 0.19
769 0.17
770 0.16
771 0.15
772 0.16
773 0.16
774 0.15
775 0.13
776 0.14
777 0.17
778 0.19
779 0.22
780 0.24
781 0.26
782 0.26
783 0.28
784 0.28
785 0.25
786 0.22
787 0.17
788 0.15
789 0.13
790 0.12
791 0.09
792 0.06
793 0.07
794 0.07
795 0.09
796 0.1
797 0.1
798 0.12
799 0.12
800 0.16
801 0.2
802 0.26
803 0.26
804 0.24
805 0.27
806 0.3
807 0.33
808 0.28
809 0.23
810 0.18
811 0.17
812 0.16
813 0.13
814 0.11
815 0.09
816 0.1
817 0.1
818 0.09
819 0.11
820 0.15
821 0.21
822 0.21
823 0.24
824 0.26
825 0.29
826 0.31
827 0.34
828 0.34
829 0.31
830 0.28
831 0.25
832 0.24
833 0.25
834 0.24
835 0.22
836 0.23
837 0.21
838 0.22
839 0.25
840 0.25
841 0.25
842 0.27
843 0.25
844 0.27
845 0.27
846 0.32
847 0.33
848 0.34
849 0.37
850 0.34
851 0.33