Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2ZMA8

Protein Details
Accession A0A0C2ZMA8    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-41CNFARAWRPKLKRRECIRAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MEVYGKCKQSIPGATASATYTCNFARAWRPKLKRRECIRAPLLPTIKPKLCINLFPTVYLTTSHTSSSTIFIHGTLEAIEAGLDESSLFYRSAHEHFTSRWSFMPGRHIPSEPRYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.29
4 0.23
5 0.2
6 0.17
7 0.14
8 0.13
9 0.14
10 0.13
11 0.15
12 0.24
13 0.31
14 0.38
15 0.46
16 0.54
17 0.62
18 0.73
19 0.79
20 0.79
21 0.79
22 0.82
23 0.77
24 0.78
25 0.75
26 0.69
27 0.62
28 0.6
29 0.54
30 0.47
31 0.46
32 0.42
33 0.38
34 0.35
35 0.32
36 0.31
37 0.3
38 0.29
39 0.28
40 0.29
41 0.28
42 0.26
43 0.27
44 0.21
45 0.2
46 0.18
47 0.17
48 0.11
49 0.12
50 0.12
51 0.11
52 0.11
53 0.11
54 0.13
55 0.11
56 0.11
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.06
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.04
73 0.05
74 0.06
75 0.06
76 0.06
77 0.09
78 0.12
79 0.14
80 0.18
81 0.19
82 0.2
83 0.21
84 0.29
85 0.29
86 0.28
87 0.28
88 0.28
89 0.28
90 0.29
91 0.38
92 0.36
93 0.41
94 0.42
95 0.43
96 0.44