A0A0C3DBH1

UniProt ID: A0A0C3DBH1   Organism: Scleroderma citrinum Foug A
Gene: SCLCIDRAFT_1218904   Protein: Uncharacterized protein
Length: 149 AA

Protein Details

• Accession: A0A0C3DBH1
• Localization Confidence: High
• Confidence Score: 17.2
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  81-123	PLDLRPKKTRAIRRRLTKHEASLKTDKQRKKDIHFPPRKYAVR	Basic

• NLS Segment(s):

  Position	Sequence
  84-119	LRPKKTRAIRRRLTKHEASLKTDKQRKKDIHFPPRK

• Subcellular Location(s): nucl 24, mito 2
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR018254 Ribosomal_L29_CS
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
  • PROSITE:
    • PS00579 RIBOSOMAL_L29
  • CDD:
    • cd00427 Ribosomal_L29_HIP
• Amino Acid Sequences: MPSKIKAYELQSKSKNDLTKQLRELKGELLALRVQKVAGGAPSKLTKINVIRKSIARVLTVMNQKARNNLREYYKNKKYLPLDLRPKKTRAIRRRLTKHEASLKTDKQRKKDIHFPPRKYAVRA

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.57
2, 0.56
3, 0.49
4, 0.54
5, 0.52
6, 0.54
7, 0.57
8, 0.62
9, 0.59
10, 0.56
11, 0.55
12, 0.47
13, 0.43
14, 0.36
15, 0.29
16, 0.21
17, 0.21
18, 0.19
19, 0.18
20, 0.16
21, 0.13
22, 0.12
23, 0.12
24, 0.1
25, 0.11
26, 0.11
27, 0.11
28, 0.13
29, 0.14
30, 0.15
31, 0.16
32, 0.15
33, 0.18
34, 0.23
35, 0.33
36, 0.35
37, 0.37
38, 0.39
39, 0.39
40, 0.43
41, 0.41
42, 0.36
43, 0.26
44, 0.22
45, 0.2
46, 0.23
47, 0.26
48, 0.24
49, 0.24
50, 0.26
51, 0.26
52, 0.32
53, 0.34
54, 0.32
55, 0.32
56, 0.33
57, 0.36
58, 0.41
59, 0.46
60, 0.49
61, 0.54
62, 0.57
63, 0.55
64, 0.58
65, 0.55
66, 0.56
67, 0.57
68, 0.57
69, 0.6
70, 0.62
71, 0.7
72, 0.68
73, 0.67
74, 0.65
75, 0.67
76, 0.68
77, 0.67
78, 0.69
79, 0.7
80, 0.76
81, 0.83
82, 0.85
83, 0.84
84, 0.8
85, 0.78
86, 0.78
87, 0.73
88, 0.69
89, 0.68
90, 0.67
91, 0.69
92, 0.72
93, 0.69
94, 0.66
95, 0.72
96, 0.72
97, 0.72
98, 0.74
99, 0.75
100, 0.78
101, 0.82
102, 0.82
103, 0.81
104, 0.83