Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DBH1

Protein Details
Accession A0A0C3DBH1    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRLTKHEASLKTDKQRKKDIHFPPRKYAVRBasic
NLS Segment(s)
PositionSequence
84-119LRPKKTRAIRRRLTKHEASLKTDKQRKKDIHFPPRK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPSKIKAYELQSKSKNDLTKQLRELKGELLALRVQKVAGGAPSKLTKINVIRKSIARVLTVMNQKARNNLREYYKNKKYLPLDLRPKKTRAIRRRLTKHEASLKTDKQRKKDIHFPPRKYAVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.49
4 0.54
5 0.52
6 0.54
7 0.57
8 0.62
9 0.59
10 0.56
11 0.55
12 0.47
13 0.43
14 0.36
15 0.29
16 0.21
17 0.21
18 0.19
19 0.18
20 0.16
21 0.13
22 0.12
23 0.12
24 0.1
25 0.11
26 0.11
27 0.11
28 0.13
29 0.14
30 0.15
31 0.16
32 0.15
33 0.18
34 0.23
35 0.33
36 0.35
37 0.37
38 0.39
39 0.39
40 0.43
41 0.41
42 0.36
43 0.26
44 0.22
45 0.2
46 0.23
47 0.26
48 0.24
49 0.24
50 0.26
51 0.26
52 0.32
53 0.34
54 0.32
55 0.32
56 0.33
57 0.36
58 0.41
59 0.46
60 0.49
61 0.54
62 0.57
63 0.55
64 0.58
65 0.55
66 0.56
67 0.57
68 0.57
69 0.6
70 0.62
71 0.7
72 0.68
73 0.67
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.85
83 0.84
84 0.8
85 0.78
86 0.78
87 0.73
88 0.69
89 0.68
90 0.67
91 0.69
92 0.72
93 0.69
94 0.66
95 0.72
96 0.72
97 0.72
98 0.74
99 0.75
100 0.78
101 0.82
102 0.82
103 0.81
104 0.83