Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DBK2

Protein Details
Accession A0A0C3DBK2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MWLAMRREKCDRRHFRRMRFPPFDDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 6, cyto 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012591  PRO8NT  
IPR027652  PRP8  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF08082  PRO8NT  
Amino Acid Sequences MWLAMRREKCDRRHFRRMRFPPFDDEEPPLNYGDNVLDVEPLEAIQLELDSEEDASIIDWFYDPKPLIDTPAVNGPSYHYWSLTLPVMANLYRLGCTLLSDRPDNNSSYLFDKKSFFTTNALNMVIPGGPKFEPLYCDMDSFDEDWNEFNHINKVII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.9
4 0.9
5 0.9
6 0.87
7 0.82
8 0.79
9 0.76
10 0.7
11 0.61
12 0.56
13 0.48
14 0.42
15 0.39
16 0.31
17 0.24
18 0.2
19 0.17
20 0.13
21 0.1
22 0.09
23 0.08
24 0.08
25 0.07
26 0.08
27 0.07
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.09
50 0.09
51 0.09
52 0.12
53 0.12
54 0.14
55 0.14
56 0.14
57 0.12
58 0.18
59 0.18
60 0.15
61 0.15
62 0.15
63 0.15
64 0.18
65 0.17
66 0.11
67 0.11
68 0.12
69 0.14
70 0.12
71 0.11
72 0.08
73 0.08
74 0.09
75 0.08
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.07
84 0.09
85 0.11
86 0.14
87 0.15
88 0.15
89 0.19
90 0.21
91 0.21
92 0.2
93 0.19
94 0.18
95 0.21
96 0.25
97 0.22
98 0.22
99 0.23
100 0.23
101 0.27
102 0.28
103 0.25
104 0.24
105 0.25
106 0.26
107 0.27
108 0.26
109 0.21
110 0.18
111 0.18
112 0.15
113 0.13
114 0.09
115 0.09
116 0.09
117 0.1
118 0.12
119 0.13
120 0.15
121 0.17
122 0.22
123 0.21
124 0.22
125 0.21
126 0.21
127 0.22
128 0.21
129 0.2
130 0.16
131 0.15
132 0.15
133 0.16
134 0.18
135 0.16
136 0.17
137 0.2