Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CZ10

Protein Details
Accession E9CZ10   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
108-138ANGMKKRGPGRPKKGEAKKQQKTPTPRSTDGBasic
NLS Segment(s)
PositionSequence
110-135GMKKRGPGRPKKGEAKKQQKTPTPRS
Subcellular Location(s) nucl 15, mito_nucl 12.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MSAEAVNGGPVAQPVPARDAQENKEATPQPEKPIEVNGDAAQPEEKEKATEGEKAIGEKREHDESGTAKEGKATSEGPPEKKQKVETEKQPDGEAKPASPNRENVDAANGMKKRGPGRPKKGEAKKQQKTPTPRSTDGIGSRTRSRTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.17
4 0.2
5 0.24
6 0.29
7 0.31
8 0.38
9 0.38
10 0.34
11 0.39
12 0.39
13 0.38
14 0.4
15 0.39
16 0.37
17 0.39
18 0.4
19 0.33
20 0.35
21 0.35
22 0.28
23 0.28
24 0.23
25 0.21
26 0.19
27 0.19
28 0.14
29 0.12
30 0.12
31 0.12
32 0.11
33 0.1
34 0.11
35 0.13
36 0.14
37 0.18
38 0.17
39 0.19
40 0.19
41 0.2
42 0.22
43 0.24
44 0.23
45 0.22
46 0.24
47 0.24
48 0.24
49 0.22
50 0.22
51 0.18
52 0.22
53 0.23
54 0.19
55 0.16
56 0.17
57 0.17
58 0.15
59 0.15
60 0.13
61 0.11
62 0.19
63 0.22
64 0.24
65 0.3
66 0.35
67 0.35
68 0.36
69 0.38
70 0.38
71 0.44
72 0.47
73 0.5
74 0.54
75 0.56
76 0.54
77 0.53
78 0.47
79 0.4
80 0.38
81 0.29
82 0.21
83 0.25
84 0.27
85 0.3
86 0.3
87 0.33
88 0.31
89 0.35
90 0.35
91 0.28
92 0.29
93 0.26
94 0.24
95 0.28
96 0.24
97 0.21
98 0.22
99 0.25
100 0.26
101 0.32
102 0.42
103 0.45
104 0.55
105 0.64
106 0.72
107 0.79
108 0.85
109 0.87
110 0.88
111 0.89
112 0.87
113 0.87
114 0.87
115 0.86
116 0.85
117 0.85
118 0.84
119 0.81
120 0.76
121 0.7
122 0.64
123 0.62
124 0.58
125 0.53
126 0.47
127 0.44
128 0.47
129 0.51