Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ECA3

Protein Details
Accession A0A0C3ECA3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
172-191SVRGAAGRNTLRKKKRQPKWHydrophilic
NLS Segment(s)
PositionSequence
176-191AAGRNTLRKKKRQPKW
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences LDPGKLPPAYFEFGETRHEAPSIIRDPDVSRAEAATTAVAVPAPPPEPKPAGLTKRQIKAAKPKTAGPSWFDLPAPTEADIPRLHREIEALRLRNQLDPKRFYRKDEGEGKGIKGLPKHFAIGTIVPTTTPFGTGSSDNLPRAERKRTLVDELVDDAEARRYAKKKFDNLQSVRGAAGRNTLRKKKRQPKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.25
4 0.23
5 0.23
6 0.2
7 0.19
8 0.25
9 0.25
10 0.24
11 0.22
12 0.23
13 0.24
14 0.32
15 0.33
16 0.26
17 0.22
18 0.2
19 0.21
20 0.2
21 0.18
22 0.11
23 0.08
24 0.07
25 0.07
26 0.06
27 0.05
28 0.05
29 0.07
30 0.09
31 0.1
32 0.12
33 0.16
34 0.18
35 0.19
36 0.24
37 0.3
38 0.34
39 0.39
40 0.47
41 0.5
42 0.53
43 0.59
44 0.58
45 0.55
46 0.61
47 0.63
48 0.63
49 0.57
50 0.58
51 0.56
52 0.56
53 0.53
54 0.44
55 0.4
56 0.32
57 0.31
58 0.26
59 0.21
60 0.19
61 0.18
62 0.16
63 0.12
64 0.13
65 0.11
66 0.14
67 0.15
68 0.16
69 0.17
70 0.16
71 0.16
72 0.14
73 0.16
74 0.14
75 0.22
76 0.25
77 0.24
78 0.25
79 0.28
80 0.29
81 0.3
82 0.35
83 0.33
84 0.33
85 0.36
86 0.38
87 0.46
88 0.46
89 0.47
90 0.5
91 0.48
92 0.49
93 0.53
94 0.51
95 0.46
96 0.46
97 0.43
98 0.37
99 0.34
100 0.29
101 0.23
102 0.22
103 0.2
104 0.19
105 0.2
106 0.17
107 0.17
108 0.17
109 0.15
110 0.16
111 0.14
112 0.12
113 0.11
114 0.12
115 0.12
116 0.1
117 0.1
118 0.08
119 0.08
120 0.1
121 0.11
122 0.13
123 0.16
124 0.19
125 0.19
126 0.19
127 0.2
128 0.24
129 0.28
130 0.33
131 0.32
132 0.34
133 0.41
134 0.43
135 0.47
136 0.45
137 0.42
138 0.38
139 0.36
140 0.32
141 0.25
142 0.21
143 0.16
144 0.15
145 0.14
146 0.13
147 0.17
148 0.2
149 0.25
150 0.35
151 0.43
152 0.49
153 0.57
154 0.66
155 0.71
156 0.71
157 0.74
158 0.68
159 0.6
160 0.52
161 0.45
162 0.36
163 0.26
164 0.3
165 0.29
166 0.35
167 0.44
168 0.53
169 0.6
170 0.69
171 0.8