Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CS53

Protein Details
Accession A0A0C3CS53    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-86VGSQQSSRKRCPKGRSVRSSQLRLRRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 9, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences LKYWENLHTTRPRLARMALDFLLAPASSVDAERAFSGGRLQVNHLQHQLSSQSFKAQVAVGSQQSSRKRCPKGRSVRSSQLRLRRTSILQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.38
4 0.39
5 0.32
6 0.3
7 0.26
8 0.23
9 0.22
10 0.15
11 0.12
12 0.06
13 0.06
14 0.06
15 0.06
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.06
22 0.06
23 0.07
24 0.09
25 0.1
26 0.1
27 0.13
28 0.18
29 0.2
30 0.22
31 0.23
32 0.2
33 0.19
34 0.19
35 0.18
36 0.14
37 0.14
38 0.12
39 0.13
40 0.13
41 0.14
42 0.14
43 0.12
44 0.11
45 0.11
46 0.14
47 0.13
48 0.13
49 0.14
50 0.2
51 0.26
52 0.3
53 0.36
54 0.43
55 0.51
56 0.58
57 0.65
58 0.69
59 0.74
60 0.8
61 0.82
62 0.82
63 0.84
64 0.84
65 0.84
66 0.82
67 0.8
68 0.76
69 0.71
70 0.66
71 0.62