Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3A9U0

Protein Details
Accession A0A0C3A9U0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-75ETSLKTEKQRKKDIHFPPRKYAVRHydrophilic
NLS Segment(s)
PositionSequence
39-71KKTRAIRRRLTKHETSLKTEKQRKKDIHFPPRK
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Amino Acid Sequences NVIRKSIARVLTVMNQKARNNLREYCKNKKYLPLDLQPKKTRAIRRRLTKHETSLKTEKQRKKDIHFPPRKYAVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.41
4 0.48
5 0.51
6 0.48
7 0.46
8 0.48
9 0.5
10 0.55
11 0.61
12 0.62
13 0.63
14 0.64
15 0.6
16 0.63
17 0.59
18 0.57
19 0.57
20 0.55
21 0.59
22 0.59
23 0.66
24 0.61
25 0.59
26 0.54
27 0.53
28 0.55
29 0.52
30 0.57
31 0.57
32 0.64
33 0.72
34 0.76
35 0.78
36 0.74
37 0.75
38 0.74
39 0.69
40 0.66
41 0.66
42 0.65
43 0.67
44 0.72
45 0.71
46 0.7
47 0.76
48 0.76
49 0.76
50 0.78
51 0.79
52 0.8
53 0.83
54 0.81
55 0.8
56 0.82