Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZW56

Protein Details
Accession A0A0C2ZW56    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-56VPSAKARDQGKQKAKKTNPRPRPPKSKPSPKAKKRKANSDRSASEHydrophilic
61-88DEPTTLKSKKQSHKKKRQCHQKSISSAEHydrophilic
NLS Segment(s)
PositionSequence
13-48PSAKARDQGKQKAKKTNPRPRPPKSKPSPKAKKRKA
69-76KKQSHKKK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MESRKSTHSNKVPSAKARDQGKQKAKKTNPRPRPPKSKPSPKAKKRKANSDRSASEGDDDDEPTTLKSKKQSHKKKRQCHQKSISSAEEVEDGDSNKDEVEVVDEGHSDGHESDEVCMERVLVLIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.68
3 0.67
4 0.65
5 0.64
6 0.66
7 0.69
8 0.72
9 0.73
10 0.74
11 0.77
12 0.8
13 0.83
14 0.85
15 0.86
16 0.86
17 0.88
18 0.91
19 0.9
20 0.92
21 0.89
22 0.89
23 0.89
24 0.89
25 0.87
26 0.88
27 0.9
28 0.89
29 0.91
30 0.91
31 0.9
32 0.86
33 0.89
34 0.87
35 0.87
36 0.84
37 0.81
38 0.72
39 0.66
40 0.61
41 0.49
42 0.41
43 0.3
44 0.24
45 0.15
46 0.14
47 0.1
48 0.08
49 0.08
50 0.07
51 0.1
52 0.09
53 0.1
54 0.17
55 0.26
56 0.35
57 0.45
58 0.57
59 0.65
60 0.76
61 0.85
62 0.88
63 0.89
64 0.92
65 0.9
66 0.9
67 0.87
68 0.85
69 0.81
70 0.77
71 0.69
72 0.59
73 0.5
74 0.4
75 0.32
76 0.23
77 0.17
78 0.13
79 0.11
80 0.1
81 0.1
82 0.1
83 0.08
84 0.08
85 0.07
86 0.06
87 0.09
88 0.08
89 0.09
90 0.09
91 0.09
92 0.1
93 0.1
94 0.1
95 0.07
96 0.07
97 0.08
98 0.09
99 0.09
100 0.1
101 0.15
102 0.16
103 0.16
104 0.16
105 0.14
106 0.13