Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2YKL0

Protein Details
Accession A0A0C2YKL0    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-29PFPWSIRRPNHLRTKRYPNQHGQEISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 11.333, cyto_nucl 4.333, cyto 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017998  Chaperone_TCP-1  
IPR002423  Cpn60/GroEL/TCP-1  
IPR027409  GroEL-like_apical_dom_sf  
IPR027413  GROEL-like_equatorial_sf  
IPR027410  TCP-1-like_intermed_sf  
Gene Ontology GO:0032991  C:protein-containing complex  
GO:0005524  F:ATP binding  
GO:0140662  F:ATP-dependent protein folding chaperone  
Pfam View protein in Pfam  
PF00118  Cpn60_TCP1  
Amino Acid Sequences MPHPFPWSIRRPNHLRTKRYPNQHGQEISMIPMVALPLESRFISVKTRYPMQFSGMAAVEAFAVVLHGSTNQIVDVSQGEHLLRDAVTVLSQTDRGIRIVLGGGCSKMPMKRAVDETAIKANRKSAIAVEPFVHALQQIRTIRAENAGYNANDFVTYLWAPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.77
3 0.76
4 0.8
5 0.8
6 0.83
7 0.83
8 0.82
9 0.8
10 0.8
11 0.73
12 0.64
13 0.59
14 0.49
15 0.42
16 0.32
17 0.24
18 0.15
19 0.13
20 0.11
21 0.07
22 0.06
23 0.05
24 0.05
25 0.07
26 0.07
27 0.08
28 0.09
29 0.11
30 0.15
31 0.17
32 0.22
33 0.24
34 0.31
35 0.3
36 0.34
37 0.34
38 0.33
39 0.33
40 0.28
41 0.27
42 0.21
43 0.19
44 0.14
45 0.13
46 0.1
47 0.06
48 0.06
49 0.03
50 0.03
51 0.02
52 0.03
53 0.02
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.07
86 0.09
87 0.09
88 0.09
89 0.08
90 0.09
91 0.08
92 0.09
93 0.1
94 0.1
95 0.12
96 0.16
97 0.18
98 0.21
99 0.25
100 0.27
101 0.3
102 0.31
103 0.31
104 0.34
105 0.35
106 0.33
107 0.3
108 0.3
109 0.29
110 0.27
111 0.26
112 0.2
113 0.24
114 0.25
115 0.26
116 0.24
117 0.22
118 0.23
119 0.22
120 0.19
121 0.13
122 0.12
123 0.12
124 0.19
125 0.2
126 0.21
127 0.23
128 0.25
129 0.25
130 0.27
131 0.28
132 0.21
133 0.22
134 0.25
135 0.24
136 0.23
137 0.22
138 0.18
139 0.16
140 0.15
141 0.13
142 0.12