Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZA17

Protein Details
Accession A0A0C2ZA17    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-71NQRQVSRTPQRPRHIRHPWHQRRHRGVGTCGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, cyto 4.5, pero 4, mito 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MISAHQGYYNKHVPTEDRACPCGDPLQSRDHIITACPTYENQRQVSRTPQRPRHIRHPWHQRRHRGVGTCGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.4
3 0.4
4 0.37
5 0.38
6 0.38
7 0.37
8 0.35
9 0.32
10 0.27
11 0.24
12 0.22
13 0.26
14 0.26
15 0.27
16 0.26
17 0.22
18 0.19
19 0.16
20 0.16
21 0.11
22 0.1
23 0.1
24 0.1
25 0.14
26 0.19
27 0.22
28 0.23
29 0.27
30 0.29
31 0.31
32 0.41
33 0.45
34 0.49
35 0.56
36 0.61
37 0.67
38 0.74
39 0.79
40 0.8
41 0.81
42 0.81
43 0.81
44 0.83
45 0.85
46 0.87
47 0.89
48 0.89
49 0.88
50 0.88
51 0.86
52 0.81