Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3A6R6

Protein Details
Accession A0A0C3A6R6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
86-106AETNRKRRKLERERRALERPVBasic
NLS Segment(s)
PositionSequence
90-104RKRRKLERERRALER
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MLRERVYVEKMEGLAWEEALVWEGTHPELHHLQDELTKRRDKRLMLAERKREYEIGALERKRKEENVNVWDHWEHARDELQTDMVAETNRKRRKLERERRALERPVGARGIPVPILNPPPAPTLREITID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.12
4 0.09
5 0.09
6 0.1
7 0.09
8 0.06
9 0.06
10 0.07
11 0.07
12 0.08
13 0.08
14 0.11
15 0.14
16 0.15
17 0.16
18 0.16
19 0.16
20 0.19
21 0.25
22 0.27
23 0.3
24 0.35
25 0.35
26 0.42
27 0.47
28 0.43
29 0.45
30 0.49
31 0.55
32 0.59
33 0.66
34 0.68
35 0.66
36 0.67
37 0.61
38 0.51
39 0.41
40 0.34
41 0.27
42 0.23
43 0.26
44 0.26
45 0.3
46 0.31
47 0.32
48 0.31
49 0.31
50 0.3
51 0.31
52 0.36
53 0.37
54 0.39
55 0.37
56 0.38
57 0.35
58 0.32
59 0.26
60 0.2
61 0.14
62 0.12
63 0.14
64 0.12
65 0.13
66 0.12
67 0.11
68 0.09
69 0.09
70 0.08
71 0.07
72 0.08
73 0.09
74 0.14
75 0.24
76 0.3
77 0.32
78 0.36
79 0.44
80 0.54
81 0.64
82 0.7
83 0.71
84 0.76
85 0.79
86 0.82
87 0.81
88 0.75
89 0.68
90 0.64
91 0.55
92 0.48
93 0.43
94 0.36
95 0.3
96 0.25
97 0.24
98 0.18
99 0.16
100 0.13
101 0.16
102 0.19
103 0.2
104 0.2
105 0.19
106 0.23
107 0.25
108 0.26
109 0.26
110 0.27