Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3E391

Protein Details
Accession A0A0C3E391    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-47EEEAERQKKKKPKSYLEEELAAcidic
NLS Segment(s)
PositionSequence
32-65RQKKKKPKSYLEEELAKYAKGRASQKKAKDGRKK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences ARRTEIEKMEAEIRRLTRRRESGEDSEEEAERQKKKKPKSYLEEELAKYAKGRASQKKAKDGRKKDEGDVLAALSSFRGMLQAATPVSLGMGEHAGDDDANEEDAQEAGGRDHGMEVDDDRGFISHVLHFPKDDGEETRKAERDYEVIDPRQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.49
4 0.51
5 0.56
6 0.61
7 0.63
8 0.66
9 0.64
10 0.64
11 0.6
12 0.54
13 0.48
14 0.41
15 0.34
16 0.32
17 0.3
18 0.3
19 0.31
20 0.36
21 0.42
22 0.51
23 0.61
24 0.66
25 0.71
26 0.74
27 0.8
28 0.81
29 0.79
30 0.76
31 0.67
32 0.61
33 0.51
34 0.42
35 0.33
36 0.26
37 0.22
38 0.21
39 0.28
40 0.33
41 0.41
42 0.49
43 0.54
44 0.62
45 0.68
46 0.72
47 0.75
48 0.74
49 0.73
50 0.75
51 0.73
52 0.64
53 0.62
54 0.53
55 0.44
56 0.35
57 0.27
58 0.17
59 0.14
60 0.12
61 0.06
62 0.05
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.1
105 0.1
106 0.1
107 0.1
108 0.1
109 0.09
110 0.09
111 0.1
112 0.1
113 0.14
114 0.18
115 0.18
116 0.19
117 0.19
118 0.21
119 0.21
120 0.21
121 0.22
122 0.24
123 0.29
124 0.32
125 0.38
126 0.4
127 0.39
128 0.39
129 0.36
130 0.34
131 0.33
132 0.37
133 0.37