Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3A0J4

Protein Details
Accession A0A0C3A0J4    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
5-54DEIFNKKKTQSCPSKPSCKRSHPDTVESPSKPTKRKKTMRPKKTPSAHGGHydrophilic
NLS Segment(s)
PositionSequence
35-49KPTKRKKTMRPKKTP
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSEIDEIFNKKKTQSCPSKPSCKRSHPDTVESPSKPTKRKKTMRPKKTPSAHGGDDERFKDSRGTSHRSKTEEGYVIYREDELGISNEGGDTPLCPFDCNCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.66
4 0.73
5 0.8
6 0.82
7 0.85
8 0.84
9 0.82
10 0.79
11 0.76
12 0.78
13 0.72
14 0.7
15 0.67
16 0.64
17 0.62
18 0.56
19 0.53
20 0.5
21 0.51
22 0.52
23 0.55
24 0.59
25 0.62
26 0.71
27 0.77
28 0.81
29 0.86
30 0.9
31 0.91
32 0.88
33 0.88
34 0.86
35 0.81
36 0.74
37 0.69
38 0.59
39 0.51
40 0.46
41 0.38
42 0.34
43 0.29
44 0.26
45 0.2
46 0.19
47 0.19
48 0.17
49 0.22
50 0.24
51 0.3
52 0.33
53 0.4
54 0.44
55 0.45
56 0.47
57 0.43
58 0.43
59 0.4
60 0.37
61 0.32
62 0.29
63 0.26
64 0.24
65 0.21
66 0.16
67 0.12
68 0.11
69 0.09
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.08
76 0.09
77 0.08
78 0.07
79 0.07
80 0.11
81 0.12
82 0.13
83 0.14