Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AWJ1

Protein Details
Accession A0A0C3AWJ1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-45LKNNQLCVQIRRRRSRKQLRSSPYPKWTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MDRTAGDLSTTNSIDELKNNQLCVQIRRRRSRKQLRSSPYPKWTFDNELDKHTHALLDRLALVQSSLSCRSRPQPQLSPISRLPSELLASIFLHAIEAPPLNNVLPSQFIIASVCKAWRTVAFSTPEYWGRLYVSPLMPVSVYETLLARSSPFPLYVQFFLWRPFKRKQYVSSNEPILERLLDTLKSEKHRLRFLSMQTSNCSWTARALMGSWINKNLVDPEPDSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.22
4 0.26
5 0.28
6 0.29
7 0.3
8 0.34
9 0.37
10 0.41
11 0.47
12 0.47
13 0.54
14 0.65
15 0.72
16 0.76
17 0.83
18 0.87
19 0.87
20 0.9
21 0.9
22 0.88
23 0.91
24 0.88
25 0.86
26 0.84
27 0.78
28 0.7
29 0.64
30 0.6
31 0.56
32 0.54
33 0.55
34 0.47
35 0.46
36 0.46
37 0.43
38 0.39
39 0.33
40 0.28
41 0.18
42 0.19
43 0.15
44 0.13
45 0.12
46 0.12
47 0.11
48 0.09
49 0.09
50 0.07
51 0.08
52 0.1
53 0.13
54 0.14
55 0.15
56 0.17
57 0.22
58 0.3
59 0.37
60 0.41
61 0.45
62 0.49
63 0.59
64 0.59
65 0.6
66 0.53
67 0.5
68 0.43
69 0.36
70 0.31
71 0.22
72 0.2
73 0.15
74 0.13
75 0.1
76 0.1
77 0.1
78 0.09
79 0.07
80 0.07
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.05
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.07
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.08
105 0.08
106 0.12
107 0.13
108 0.17
109 0.2
110 0.2
111 0.21
112 0.23
113 0.23
114 0.2
115 0.19
116 0.15
117 0.14
118 0.14
119 0.14
120 0.15
121 0.14
122 0.14
123 0.14
124 0.14
125 0.12
126 0.11
127 0.13
128 0.1
129 0.1
130 0.09
131 0.09
132 0.09
133 0.1
134 0.1
135 0.08
136 0.08
137 0.1
138 0.1
139 0.11
140 0.11
141 0.12
142 0.16
143 0.16
144 0.17
145 0.17
146 0.17
147 0.21
148 0.28
149 0.3
150 0.32
151 0.38
152 0.45
153 0.51
154 0.55
155 0.59
156 0.62
157 0.66
158 0.67
159 0.66
160 0.62
161 0.55
162 0.51
163 0.43
164 0.33
165 0.26
166 0.19
167 0.15
168 0.13
169 0.12
170 0.13
171 0.17
172 0.21
173 0.26
174 0.33
175 0.37
176 0.41
177 0.48
178 0.49
179 0.51
180 0.53
181 0.53
182 0.57
183 0.56
184 0.53
185 0.5
186 0.49
187 0.45
188 0.39
189 0.35
190 0.25
191 0.23
192 0.22
193 0.19
194 0.18
195 0.16
196 0.2
197 0.25
198 0.28
199 0.28
200 0.28
201 0.28
202 0.27
203 0.28
204 0.27
205 0.24
206 0.24