Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DEQ6

Protein Details
Accession E9DEQ6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-33GFVRSKSHGRKHRVRLPRRALVBasic
NLS Segment(s)
PositionSequence
16-30SKSHGRKHRVRLPRR
Subcellular Location(s) mito 23, nucl 1, cyto 1, plas 1, cyto_nucl 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MPDGICFRPGAGFVRSKSHGRKHRVRLPRRALVGSQDRAATQIVSVHGIPTFLIHTPFLWMWVLGRQGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.36
4 0.42
5 0.48
6 0.53
7 0.57
8 0.66
9 0.69
10 0.75
11 0.8
12 0.81
13 0.82
14 0.81
15 0.78
16 0.72
17 0.64
18 0.55
19 0.51
20 0.49
21 0.39
22 0.32
23 0.26
24 0.22
25 0.21
26 0.21
27 0.14
28 0.08
29 0.09
30 0.08
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.07
38 0.08
39 0.07
40 0.09
41 0.09
42 0.09
43 0.13
44 0.13
45 0.14
46 0.13
47 0.13
48 0.12
49 0.16