Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3E7J1

Protein Details
Accession A0A0C3E7J1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSLRSKTKRAFRAKKRSSGVYAHydrophilic
NLS Segment(s)
PositionSequence
6-18RSKTKRAFRAKKR
104-144GSRREEWRKSKGMDGIPQRRGMNRQGGLAARRRAGRPSRRR
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKTKRAFRAKKRSSGVYAATEAARLNRLNAKLATTISEGNKYVGDGDGEDSEGMVTPELKSDHASSAARCEDVMDLDTSEQKPSVVSSGSVSTHGSRGSRREEWRKSKGMDGIPQRRGMNRQGGLAARRRAGRPSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.85
5 0.81
6 0.75
7 0.7
8 0.63
9 0.56
10 0.49
11 0.41
12 0.34
13 0.28
14 0.24
15 0.19
16 0.18
17 0.14
18 0.15
19 0.18
20 0.19
21 0.23
22 0.23
23 0.24
24 0.22
25 0.22
26 0.22
27 0.18
28 0.21
29 0.18
30 0.2
31 0.18
32 0.18
33 0.17
34 0.15
35 0.14
36 0.11
37 0.09
38 0.07
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.06
51 0.06
52 0.07
53 0.08
54 0.09
55 0.1
56 0.12
57 0.13
58 0.11
59 0.14
60 0.14
61 0.13
62 0.12
63 0.11
64 0.09
65 0.09
66 0.1
67 0.07
68 0.06
69 0.07
70 0.09
71 0.09
72 0.1
73 0.09
74 0.08
75 0.08
76 0.08
77 0.09
78 0.07
79 0.07
80 0.08
81 0.1
82 0.11
83 0.12
84 0.13
85 0.12
86 0.13
87 0.14
88 0.14
89 0.15
90 0.19
91 0.24
92 0.3
93 0.38
94 0.47
95 0.56
96 0.63
97 0.68
98 0.71
99 0.67
100 0.65
101 0.64
102 0.59
103 0.57
104 0.58
105 0.6
106 0.57
107 0.6
108 0.56
109 0.53
110 0.52
111 0.5
112 0.49
113 0.41
114 0.39
115 0.38
116 0.41
117 0.42
118 0.46
119 0.45
120 0.4
121 0.43
122 0.42
123 0.47
124 0.53