Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3E243

Protein Details
Accession A0A0C3E243    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-38APPASCHLRRWTRPPPHRRRRRRSHQSHSAAPTHydrophilic
NLS Segment(s)
PositionSequence
15-29RWTRPPPHRRRRRRS
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MTQPSAPPASCHLRRWTRPPPHRRRRRRSHQSHSAAPTTSTIPTLMTMTTCVNDAAVTTALPPPLSTRQPPAWPPSPPLSTMDHHNLDDDDSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.69
4 0.7
5 0.76
6 0.83
7 0.84
8 0.86
9 0.91
10 0.94
11 0.94
12 0.94
13 0.95
14 0.95
15 0.95
16 0.94
17 0.93
18 0.89
19 0.86
20 0.79
21 0.7
22 0.59
23 0.49
24 0.4
25 0.3
26 0.23
27 0.16
28 0.12
29 0.09
30 0.09
31 0.09
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.1
51 0.15
52 0.18
53 0.19
54 0.24
55 0.28
56 0.34
57 0.37
58 0.41
59 0.41
60 0.4
61 0.43
62 0.44
63 0.42
64 0.38
65 0.37
66 0.35
67 0.31
68 0.35
69 0.38
70 0.35
71 0.33
72 0.33
73 0.31
74 0.29