Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3E674

Protein Details
Accession A0A0C3E674    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-104EDDPSKPFSQPKKPVQRYRSPHRVVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 1, cyto 1, plas 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MCSRPVGKTSVLVRNVLTGQLCILFQISVRLGVTLPGSIPAVKVHKLQEDGFFTPPECLNSRVGSVLMIKRPWLPLVVEDDPSKPFSQPKKPVQRYRSPHRVVCASPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.3
4 0.24
5 0.15
6 0.13
7 0.13
8 0.13
9 0.09
10 0.09
11 0.07
12 0.07
13 0.09
14 0.09
15 0.09
16 0.1
17 0.1
18 0.09
19 0.1
20 0.1
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.09
28 0.11
29 0.12
30 0.15
31 0.16
32 0.18
33 0.21
34 0.21
35 0.23
36 0.24
37 0.25
38 0.24
39 0.22
40 0.19
41 0.18
42 0.17
43 0.16
44 0.13
45 0.13
46 0.13
47 0.14
48 0.14
49 0.13
50 0.13
51 0.11
52 0.13
53 0.14
54 0.15
55 0.15
56 0.15
57 0.16
58 0.17
59 0.17
60 0.15
61 0.13
62 0.12
63 0.2
64 0.2
65 0.21
66 0.21
67 0.22
68 0.22
69 0.24
70 0.23
71 0.17
72 0.22
73 0.28
74 0.38
75 0.46
76 0.55
77 0.64
78 0.74
79 0.83
80 0.84
81 0.87
82 0.85
83 0.86
84 0.87
85 0.82
86 0.76
87 0.73
88 0.7
89 0.61