Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3E533

Protein Details
Accession A0A0C3E533    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
81-106CQDCGDKECRGRNPKRPKQQCKVAWDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MPSTSSLEFVFHAQSSGGATHSTSIRQVALQHHINQPIQERSLKRRRMEDTIQLRKQRTCRKCAQSGCPGAGRVGYCSNPCQDCGDKECRGRNPKRPKQQCKVAWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.08
6 0.08
7 0.1
8 0.11
9 0.12
10 0.11
11 0.12
12 0.11
13 0.12
14 0.15
15 0.17
16 0.22
17 0.25
18 0.28
19 0.31
20 0.34
21 0.34
22 0.32
23 0.33
24 0.29
25 0.27
26 0.28
27 0.27
28 0.33
29 0.41
30 0.46
31 0.45
32 0.49
33 0.51
34 0.53
35 0.54
36 0.55
37 0.56
38 0.59
39 0.61
40 0.59
41 0.57
42 0.54
43 0.58
44 0.58
45 0.53
46 0.5
47 0.54
48 0.57
49 0.64
50 0.66
51 0.65
52 0.64
53 0.62
54 0.57
55 0.5
56 0.43
57 0.35
58 0.31
59 0.24
60 0.17
61 0.17
62 0.16
63 0.16
64 0.18
65 0.22
66 0.21
67 0.22
68 0.24
69 0.25
70 0.26
71 0.31
72 0.36
73 0.37
74 0.43
75 0.49
76 0.54
77 0.61
78 0.67
79 0.71
80 0.75
81 0.8
82 0.85
83 0.89
84 0.91
85 0.9
86 0.92