Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3EE37

Protein Details
Accession A0A0C3EE37    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MAVKIPIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-53KKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKI
Subcellular Location(s) mito 13.5, mito_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLMPNGLKKFLVRNVKEVEILLMHNKTYAAEIAHNVSSRNRALILERAKALGIKVTNSAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.9
4 0.91
5 0.9
6 0.9
7 0.88
8 0.86
9 0.83
10 0.76
11 0.66
12 0.62
13 0.6
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.48
57 0.4
58 0.39
59 0.36
60 0.37
61 0.28
62 0.31
63 0.33
64 0.34
65 0.34
66 0.31
67 0.25
68 0.16
69 0.16
70 0.14
71 0.11
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.1
78 0.08
79 0.09
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.15
86 0.18
87 0.18
88 0.18
89 0.16
90 0.15
91 0.18
92 0.25
93 0.29
94 0.28
95 0.28
96 0.28
97 0.27
98 0.27
99 0.25
100 0.22
101 0.18
102 0.16
103 0.18
104 0.2
105 0.22
106 0.23
107 0.26
108 0.23