Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9CZE9

Protein Details
Accession E9CZE9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
170-189EAAKNGKPRRNGEKAKPAKSBasic
NLS Segment(s)
PositionSequence
173-189KNGKPRRNGEKAKPAKS
Subcellular Location(s) cyto_nucl 13.833, nucl 13, cyto 10.5, cyto_mito 7.332
Family & Domain DBs
Amino Acid Sequences MGEPVVNGDHPQSQFINHLASYPFVSGSLENIKANPYGQKSLELADQGYSQFAKPFLPYLAKPYGYVAPYVSKADELGNEGLNRMDSTIPAVIHASENIKETIRGYVSAPFRLAEDGKGYVLETYSSERNAVGDGSFSRSKAAVSTGLRLTADSCLWLRGYLIPEAKTNEAAKNGKPRRNGEKAKPAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.18
5 0.2
6 0.17
7 0.18
8 0.18
9 0.16
10 0.14
11 0.11
12 0.13
13 0.1
14 0.13
15 0.17
16 0.17
17 0.17
18 0.17
19 0.19
20 0.18
21 0.19
22 0.21
23 0.2
24 0.22
25 0.23
26 0.25
27 0.24
28 0.25
29 0.26
30 0.22
31 0.18
32 0.15
33 0.15
34 0.12
35 0.13
36 0.11
37 0.1
38 0.1
39 0.1
40 0.1
41 0.1
42 0.11
43 0.12
44 0.15
45 0.15
46 0.2
47 0.24
48 0.24
49 0.23
50 0.24
51 0.25
52 0.22
53 0.22
54 0.18
55 0.15
56 0.16
57 0.16
58 0.14
59 0.11
60 0.11
61 0.11
62 0.1
63 0.11
64 0.1
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.09
71 0.07
72 0.06
73 0.05
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.07
80 0.08
81 0.08
82 0.08
83 0.07
84 0.08
85 0.09
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.1
92 0.09
93 0.15
94 0.16
95 0.17
96 0.17
97 0.15
98 0.15
99 0.16
100 0.15
101 0.1
102 0.11
103 0.11
104 0.1
105 0.1
106 0.1
107 0.08
108 0.08
109 0.07
110 0.07
111 0.09
112 0.1
113 0.1
114 0.11
115 0.11
116 0.11
117 0.11
118 0.1
119 0.07
120 0.07
121 0.08
122 0.13
123 0.14
124 0.14
125 0.14
126 0.14
127 0.14
128 0.14
129 0.15
130 0.16
131 0.16
132 0.21
133 0.2
134 0.22
135 0.22
136 0.21
137 0.2
138 0.15
139 0.14
140 0.12
141 0.12
142 0.12
143 0.12
144 0.12
145 0.12
146 0.13
147 0.16
148 0.19
149 0.22
150 0.22
151 0.25
152 0.28
153 0.29
154 0.3
155 0.3
156 0.28
157 0.32
158 0.33
159 0.36
160 0.44
161 0.51
162 0.53
163 0.58
164 0.63
165 0.65
166 0.73
167 0.77
168 0.76
169 0.79