Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D6U1

Protein Details
Accession A0A0C3D6U1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-75VVPGPYTLKNRHRRKRGEKATQCHGPCHydrophilic
NLS Segment(s)
PositionSequence
59-65RHRRKRG
Subcellular Location(s) mito 8, cyto 7.5, mito_nucl 7.5, nucl 7, cyto_pero 6.5
Family & Domain DBs
Amino Acid Sequences MTWREPWLNLAPAEQELGLPIADEAIQHMRANLVHSYPPYPSIYVLNYVVPGPYTLKNRHRRKRGEKATQCHGPCPYIWAGCPCCSGDCACIPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.13
3 0.1
4 0.1
5 0.08
6 0.07
7 0.06
8 0.05
9 0.05
10 0.05
11 0.06
12 0.09
13 0.1
14 0.1
15 0.1
16 0.11
17 0.11
18 0.14
19 0.13
20 0.11
21 0.12
22 0.13
23 0.14
24 0.13
25 0.15
26 0.14
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.14
33 0.11
34 0.11
35 0.1
36 0.09
37 0.08
38 0.08
39 0.08
40 0.11
41 0.15
42 0.22
43 0.32
44 0.42
45 0.53
46 0.62
47 0.69
48 0.77
49 0.82
50 0.87
51 0.88
52 0.89
53 0.88
54 0.85
55 0.83
56 0.81
57 0.72
58 0.65
59 0.57
60 0.47
61 0.37
62 0.35
63 0.31
64 0.24
65 0.24
66 0.27
67 0.28
68 0.29
69 0.31
70 0.27
71 0.25
72 0.25
73 0.25
74 0.22