Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DTR4

Protein Details
Accession A0A0C3DTR4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85GYTHSDRRRRPLRGQCHSNNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, extr 7, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MFTPAHITVLATVVKNIISAVPGAEVNLVYSMLMSWVVIGLSCYDIVYKVTGGGKANYDIDNDNAGYTHSDRRRRPLRGQCHSNNVVDWIVLPRQAASAAKAWISR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.08
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.06
16 0.05
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.05
36 0.06
37 0.07
38 0.09
39 0.1
40 0.1
41 0.1
42 0.11
43 0.12
44 0.11
45 0.12
46 0.11
47 0.11
48 0.11
49 0.11
50 0.09
51 0.08
52 0.08
53 0.09
54 0.1
55 0.17
56 0.22
57 0.3
58 0.33
59 0.42
60 0.51
61 0.56
62 0.64
63 0.66
64 0.71
65 0.73
66 0.8
67 0.76
68 0.77
69 0.74
70 0.65
71 0.55
72 0.47
73 0.37
74 0.27
75 0.23
76 0.17
77 0.15
78 0.14
79 0.14
80 0.11
81 0.12
82 0.14
83 0.14
84 0.14
85 0.16
86 0.17