Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3A918

Protein Details
Accession A0A0C3A918    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-43VADGGIVKKKKKKSKSRSQVEDSQDRHydrophilic
NLS Segment(s)
PositionSequence
23-34IVKKKKKKSKSR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MVDYDFRPGGSLKFKGGVADGGIVKKKKKKSKSRSQVEDSQDRERIGSEDADAPSGSALGSNRGSPSLSGKNDKKTDAERRFEQVQRRRLAEKVAKLASKTHKDRVSEFNSKLEALSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.21
5 0.15
6 0.17
7 0.17
8 0.17
9 0.22
10 0.24
11 0.29
12 0.35
13 0.44
14 0.5
15 0.59
16 0.67
17 0.73
18 0.82
19 0.87
20 0.9
21 0.9
22 0.87
23 0.85
24 0.81
25 0.78
26 0.71
27 0.65
28 0.57
29 0.47
30 0.41
31 0.33
32 0.27
33 0.2
34 0.16
35 0.12
36 0.13
37 0.13
38 0.14
39 0.13
40 0.11
41 0.1
42 0.09
43 0.07
44 0.05
45 0.05
46 0.07
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.08
53 0.13
54 0.16
55 0.18
56 0.25
57 0.28
58 0.35
59 0.37
60 0.38
61 0.36
62 0.37
63 0.46
64 0.47
65 0.49
66 0.45
67 0.48
68 0.52
69 0.54
70 0.56
71 0.54
72 0.54
73 0.53
74 0.54
75 0.52
76 0.47
77 0.52
78 0.49
79 0.46
80 0.45
81 0.45
82 0.43
83 0.42
84 0.47
85 0.47
86 0.5
87 0.49
88 0.51
89 0.51
90 0.52
91 0.56
92 0.58
93 0.58
94 0.57
95 0.54
96 0.5
97 0.47
98 0.44
99 0.4
100 0.32
101 0.25
102 0.2
103 0.22
104 0.21
105 0.22
106 0.24
107 0.25
108 0.24