Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DSC8

Protein Details
Accession A0A0C3DSC8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-74DDSYHSHKHRPDNNNDHQHQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15.333, nucl 14, cyto 10.5, cyto_pero 6.998
Family & Domain DBs
Amino Acid Sequences MTTMTDVNENNHNDLDANYSCDGIPPPPQSMTMATTWHHDPTITVINDGTTTTIDDSYHSHKHRPDNNNDHQHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.16
4 0.17
5 0.15
6 0.16
7 0.15
8 0.15
9 0.16
10 0.12
11 0.17
12 0.16
13 0.18
14 0.18
15 0.19
16 0.19
17 0.2
18 0.2
19 0.16
20 0.15
21 0.13
22 0.15
23 0.16
24 0.15
25 0.13
26 0.11
27 0.1
28 0.12
29 0.18
30 0.16
31 0.15
32 0.14
33 0.15
34 0.15
35 0.15
36 0.12
37 0.06
38 0.06
39 0.07
40 0.08
41 0.08
42 0.08
43 0.12
44 0.17
45 0.25
46 0.27
47 0.31
48 0.36
49 0.46
50 0.54
51 0.6
52 0.65
53 0.68
54 0.76