Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DKR1

Protein Details
Accession A0A0C3DKR1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYCKGRVLGHKRAKRNTRPNTSLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYCKGRVLGHKRAKRNTRPNTSLIQIEGVINKEDAQFYLGKRVAYVYRAKREIQGSKIRVIWGRVTRPHGNSGVVKSKFSSNLPPRAFGAGVRIMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.75
4 0.78
5 0.82
6 0.82
7 0.85
8 0.85
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.21
19 0.18
20 0.15
21 0.13
22 0.11
23 0.11
24 0.1
25 0.1
26 0.09
27 0.09
28 0.1
29 0.09
30 0.16
31 0.17
32 0.17
33 0.16
34 0.18
35 0.17
36 0.19
37 0.26
38 0.24
39 0.28
40 0.31
41 0.31
42 0.34
43 0.38
44 0.39
45 0.38
46 0.41
47 0.37
48 0.38
49 0.38
50 0.36
51 0.33
52 0.31
53 0.31
54 0.28
55 0.31
56 0.33
57 0.38
58 0.41
59 0.42
60 0.44
61 0.39
62 0.37
63 0.34
64 0.36
65 0.38
66 0.34
67 0.33
68 0.3
69 0.32
70 0.32
71 0.31
72 0.37
73 0.35
74 0.44
75 0.45
76 0.46
77 0.44
78 0.44
79 0.42
80 0.32
81 0.3
82 0.24
83 0.23
84 0.22
85 0.2
86 0.18