Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3D583

Protein Details
Accession A0A0C3D583    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66RPPQPKRPDPAPKRLSRDLRBasic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 4, extr 3, cyto_nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MVAPDNWCIAMAHPRTQSLLAPVVLVKNIASTRLGHQASTASLAFTRPPQPKRPDPAPKRLSRDLRGTNVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.3
4 0.29
5 0.23
6 0.23
7 0.16
8 0.15
9 0.15
10 0.14
11 0.13
12 0.12
13 0.09
14 0.08
15 0.08
16 0.08
17 0.09
18 0.09
19 0.11
20 0.19
21 0.19
22 0.17
23 0.17
24 0.17
25 0.16
26 0.18
27 0.15
28 0.08
29 0.08
30 0.08
31 0.09
32 0.11
33 0.19
34 0.24
35 0.28
36 0.37
37 0.45
38 0.52
39 0.6
40 0.67
41 0.71
42 0.71
43 0.78
44 0.78
45 0.79
46 0.79
47 0.81
48 0.79
49 0.74
50 0.76
51 0.73