Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DEF1

Protein Details
Accession A0A0C3DEF1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-82ASPLVRHHARNRRRVLQTRPGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, extr 9, cyto_nucl 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR006411  Fruct_bisP_bact  
Gene Ontology GO:0004332  F:fructose-bisphosphate aldolase activity  
GO:0006096  P:glycolytic process  
Amino Acid Sequences DIKALILQVSQGGCAFFAGKGPPNDNQQASITGLIDAAHHILAVAKSYNVAAVLHSDLCQEASPLVRHHARNRRRVLQTRPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.07
4 0.08
5 0.1
6 0.15
7 0.17
8 0.2
9 0.23
10 0.27
11 0.32
12 0.3
13 0.3
14 0.26
15 0.26
16 0.24
17 0.21
18 0.16
19 0.11
20 0.11
21 0.09
22 0.08
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.04
39 0.06
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.08
47 0.07
48 0.07
49 0.09
50 0.12
51 0.13
52 0.18
53 0.23
54 0.28
55 0.38
56 0.47
57 0.53
58 0.61
59 0.69
60 0.73
61 0.77
62 0.82