Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3E4Z9

Protein Details
Accession A0A0C3E4Z9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-68VKSSNTCKEKWKRIKTYKLVTRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7cyto 7extr 7cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences SWSDANTHVLLDLVATQKAKAGDGLNFKTAFWNAVAAALCNPTKGAVKSSNTCKEKWKRIKTYKLVTRICNTSGFAYSLESGVNVQPESEDIWTIFLKNNKDANSFKNKGWLYYERMKQFMPSQGKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.14
5 0.15
6 0.15
7 0.15
8 0.15
9 0.18
10 0.26
11 0.28
12 0.3
13 0.29
14 0.29
15 0.29
16 0.27
17 0.23
18 0.16
19 0.14
20 0.1
21 0.13
22 0.13
23 0.11
24 0.11
25 0.12
26 0.12
27 0.11
28 0.11
29 0.09
30 0.12
31 0.12
32 0.15
33 0.18
34 0.22
35 0.27
36 0.36
37 0.44
38 0.43
39 0.44
40 0.49
41 0.52
42 0.59
43 0.64
44 0.66
45 0.68
46 0.75
47 0.84
48 0.82
49 0.83
50 0.79
51 0.78
52 0.73
53 0.65
54 0.59
55 0.51
56 0.45
57 0.37
58 0.31
59 0.22
60 0.19
61 0.17
62 0.14
63 0.12
64 0.11
65 0.1
66 0.09
67 0.07
68 0.07
69 0.07
70 0.08
71 0.07
72 0.06
73 0.06
74 0.07
75 0.08
76 0.08
77 0.08
78 0.06
79 0.09
80 0.09
81 0.1
82 0.13
83 0.16
84 0.19
85 0.24
86 0.28
87 0.28
88 0.33
89 0.35
90 0.39
91 0.45
92 0.45
93 0.4
94 0.45
95 0.43
96 0.4
97 0.44
98 0.42
99 0.39
100 0.45
101 0.53
102 0.48
103 0.5
104 0.48
105 0.46
106 0.46
107 0.48
108 0.47
109 0.41