Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2ZUR3

Protein Details
Accession A0A0C2ZUR3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-93WKLSNRHEKRGIKRSRLRSERWRKRFADBasic
NLS Segment(s)
PositionSequence
67-98KLSNRHEKRGIKRSRLRSERWRKRFADEVRRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MALGKGESKLKKLTPAEIWAQRSKRLNLAPPADRYAGERIPVTSDLRSTFLKLSRRLHKNSVYREWKLSNRHEKRGIKRSRLRSERWRKRFADEVRRKVQLVSTIRRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.48
4 0.49
5 0.52
6 0.51
7 0.51
8 0.51
9 0.52
10 0.49
11 0.48
12 0.46
13 0.48
14 0.48
15 0.52
16 0.51
17 0.48
18 0.5
19 0.43
20 0.39
21 0.34
22 0.32
23 0.26
24 0.22
25 0.19
26 0.16
27 0.18
28 0.19
29 0.18
30 0.14
31 0.14
32 0.14
33 0.16
34 0.16
35 0.15
36 0.15
37 0.19
38 0.24
39 0.28
40 0.33
41 0.4
42 0.45
43 0.48
44 0.51
45 0.54
46 0.56
47 0.58
48 0.61
49 0.59
50 0.54
51 0.55
52 0.53
53 0.51
54 0.51
55 0.53
56 0.55
57 0.54
58 0.6
59 0.66
60 0.69
61 0.73
62 0.76
63 0.76
64 0.75
65 0.78
66 0.81
67 0.83
68 0.82
69 0.8
70 0.81
71 0.84
72 0.84
73 0.84
74 0.83
75 0.75
76 0.74
77 0.76
78 0.74
79 0.74
80 0.74
81 0.74
82 0.72
83 0.73
84 0.67
85 0.59
86 0.53
87 0.51
88 0.48
89 0.49