Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3DKC7

Protein Details
Accession A0A0C3DKC7    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
109-133ADRHPSPRSPSRRSRKRPDTREATSBasic
305-324CCTGCPPQVRLRPRPDPTRTHydrophilic
NLS Segment(s)
PositionSequence
92-126PKRPRVDTAPPKSPLRVADRHPSPRSPSRRSRKRP
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008862  Tcp11  
Pfam View protein in Pfam  
PF05794  Tcp11  
Amino Acid Sequences MGDLGHPLPPVSNCRKRKADADEECQHPIAQDTPAPADDILVEGIPRQPPSSPWLATNTARAVWPAEASPVDSAPASPLSPTEHHDSPLRSPKRPRVDTAPPKSPLRVADRHPSPRSPSRRSRKRPDTREATSHPSPHPSVLPIDSPSDSPLPPIHHPAFPHIDLSSPHIPSLHPLINRQTLKELDLAAILRNPQLRHDLLFDAGLQFRPTSGRRKRELSDRYWRAVAQELETGCTCVSFDMQWRPCECLCACRGVPIIPAQNPILTYSASRRVLTLRMPSRLRPLLTERICQPIHLPSPNRPSCCTGCPPQVRLRPRPDPTRTAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.64
4 0.7
5 0.71
6 0.72
7 0.71
8 0.73
9 0.72
10 0.68
11 0.67
12 0.59
13 0.5
14 0.39
15 0.32
16 0.25
17 0.19
18 0.18
19 0.17
20 0.18
21 0.19
22 0.2
23 0.17
24 0.16
25 0.13
26 0.12
27 0.11
28 0.08
29 0.08
30 0.07
31 0.11
32 0.13
33 0.14
34 0.14
35 0.14
36 0.16
37 0.21
38 0.27
39 0.24
40 0.24
41 0.29
42 0.33
43 0.33
44 0.36
45 0.32
46 0.27
47 0.26
48 0.24
49 0.21
50 0.17
51 0.17
52 0.13
53 0.13
54 0.12
55 0.13
56 0.13
57 0.11
58 0.11
59 0.1
60 0.1
61 0.09
62 0.1
63 0.09
64 0.08
65 0.09
66 0.12
67 0.14
68 0.17
69 0.22
70 0.22
71 0.23
72 0.28
73 0.29
74 0.32
75 0.41
76 0.42
77 0.42
78 0.49
79 0.56
80 0.63
81 0.64
82 0.61
83 0.59
84 0.66
85 0.71
86 0.71
87 0.7
88 0.64
89 0.62
90 0.58
91 0.53
92 0.47
93 0.43
94 0.4
95 0.36
96 0.42
97 0.47
98 0.55
99 0.55
100 0.53
101 0.53
102 0.57
103 0.61
104 0.59
105 0.62
106 0.65
107 0.73
108 0.8
109 0.84
110 0.86
111 0.88
112 0.89
113 0.88
114 0.85
115 0.79
116 0.77
117 0.7
118 0.67
119 0.59
120 0.54
121 0.45
122 0.41
123 0.36
124 0.3
125 0.27
126 0.2
127 0.19
128 0.16
129 0.17
130 0.14
131 0.15
132 0.14
133 0.13
134 0.14
135 0.14
136 0.12
137 0.12
138 0.13
139 0.15
140 0.16
141 0.21
142 0.21
143 0.22
144 0.22
145 0.25
146 0.27
147 0.23
148 0.23
149 0.17
150 0.16
151 0.15
152 0.2
153 0.2
154 0.16
155 0.16
156 0.15
157 0.15
158 0.15
159 0.2
160 0.18
161 0.15
162 0.17
163 0.21
164 0.28
165 0.28
166 0.28
167 0.26
168 0.23
169 0.24
170 0.23
171 0.19
172 0.12
173 0.12
174 0.12
175 0.09
176 0.1
177 0.09
178 0.09
179 0.12
180 0.12
181 0.12
182 0.16
183 0.16
184 0.17
185 0.19
186 0.17
187 0.15
188 0.16
189 0.14
190 0.12
191 0.12
192 0.11
193 0.09
194 0.08
195 0.08
196 0.11
197 0.14
198 0.22
199 0.3
200 0.38
201 0.42
202 0.48
203 0.51
204 0.58
205 0.63
206 0.6
207 0.63
208 0.6
209 0.59
210 0.55
211 0.51
212 0.42
213 0.41
214 0.34
215 0.25
216 0.24
217 0.2
218 0.21
219 0.21
220 0.2
221 0.14
222 0.13
223 0.11
224 0.07
225 0.08
226 0.07
227 0.11
228 0.2
229 0.24
230 0.29
231 0.3
232 0.34
233 0.33
234 0.38
235 0.34
236 0.3
237 0.28
238 0.3
239 0.29
240 0.29
241 0.31
242 0.26
243 0.28
244 0.27
245 0.31
246 0.26
247 0.29
248 0.25
249 0.25
250 0.24
251 0.23
252 0.2
253 0.14
254 0.15
255 0.17
256 0.24
257 0.26
258 0.26
259 0.25
260 0.27
261 0.3
262 0.33
263 0.38
264 0.36
265 0.41
266 0.44
267 0.46
268 0.52
269 0.54
270 0.5
271 0.46
272 0.46
273 0.49
274 0.49
275 0.52
276 0.45
277 0.48
278 0.47
279 0.42
280 0.38
281 0.36
282 0.38
283 0.41
284 0.43
285 0.43
286 0.54
287 0.61
288 0.62
289 0.57
290 0.57
291 0.54
292 0.57
293 0.55
294 0.52
295 0.55
296 0.59
297 0.61
298 0.64
299 0.69
300 0.71
301 0.74
302 0.76
303 0.76
304 0.77
305 0.82
306 0.79