Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZMY8

Protein Details
Accession A0A0C2ZMY8    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
13-32QVGLKEKKMRSQKRAVQPGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 11.833, cyto_nucl 5.333, cyto 5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MSFATINPWIGSQVGLKEKKMRSQKRAVQPGCSIQASIASHGYILRFIRILVLCEFYSKENLNYYATAASMVLIGVHDPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.26
4 0.33
5 0.35
6 0.43
7 0.52
8 0.56
9 0.55
10 0.64
11 0.71
12 0.73
13 0.81
14 0.74
15 0.69
16 0.63
17 0.59
18 0.52
19 0.43
20 0.32
21 0.22
22 0.24
23 0.19
24 0.17
25 0.13
26 0.1
27 0.1
28 0.1
29 0.1
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.11
36 0.11
37 0.13
38 0.12
39 0.15
40 0.14
41 0.15
42 0.16
43 0.14
44 0.17
45 0.16
46 0.17
47 0.17
48 0.19
49 0.2
50 0.19
51 0.2
52 0.16
53 0.15
54 0.14
55 0.1
56 0.09
57 0.07
58 0.06
59 0.05
60 0.05