Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3E8N3

Protein Details
Accession A0A0C3E8N3    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
90-110APPWSANARKRIRSRIRRPLIHydrophilic
NLS Segment(s)
PositionSequence
98-108RKRIRSRIRRP
Subcellular Location(s) extr 20, mito 4, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011058  Cyanovirin-N  
IPR036673  Cyanovirin-N_sf  
Pfam View protein in Pfam  
PF08881  CVNH  
Amino Acid Sequences MQFFTLSAALILAALSTRGSADSLTDWSYTCKNYYLSGSTLYATCKKENTQYDNTNLNLDKCVTNTNGVLFIIETAEIILRRAVAATSLAPPWSANARKRIRSRIRRPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.06
9 0.08
10 0.1
11 0.11
12 0.11
13 0.11
14 0.14
15 0.16
16 0.16
17 0.16
18 0.16
19 0.15
20 0.17
21 0.19
22 0.19
23 0.18
24 0.19
25 0.19
26 0.17
27 0.17
28 0.17
29 0.2
30 0.19
31 0.19
32 0.19
33 0.2
34 0.26
35 0.31
36 0.36
37 0.37
38 0.38
39 0.41
40 0.42
41 0.41
42 0.37
43 0.31
44 0.25
45 0.19
46 0.17
47 0.13
48 0.11
49 0.13
50 0.11
51 0.12
52 0.12
53 0.12
54 0.11
55 0.11
56 0.1
57 0.08
58 0.07
59 0.06
60 0.05
61 0.05
62 0.04
63 0.05
64 0.05
65 0.05
66 0.06
67 0.05
68 0.05
69 0.06
70 0.06
71 0.05
72 0.07
73 0.07
74 0.09
75 0.1
76 0.1
77 0.1
78 0.1
79 0.12
80 0.19
81 0.25
82 0.28
83 0.38
84 0.46
85 0.55
86 0.63
87 0.72
88 0.75
89 0.79
90 0.85