Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2ZP56

Protein Details
Accession A0A0C2ZP56    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
146-166FDTFRDSPKRRARRREALYGQHydrophilic
NLS Segment(s)
PositionSequence
154-159KRRARR
Subcellular Location(s) nucl 12, cyto 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
Amino Acid Sequences MGHILSLLSEHTPSKVMLTADDVPDMAGKVVLVTGGNTGIEKETARGKAAVEDLKECTGRQAHFLKLNLANLQSIKAAAEEFMRPDIELLTDDGFDLQFGTNVLGHFYLTKLLLPVLFSTALSSPDGTVRVVNTSSSGHWFGGLDFDTFRDSPKRRARRREALYGQSKTGNIIFLKELHRRYRDQGIVSTSLNPGTSPEAIHLGGQYLIPWVRDPQLGKDLWTYMEDQIANLYSYMSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.15
5 0.2
6 0.22
7 0.22
8 0.22
9 0.2
10 0.17
11 0.17
12 0.17
13 0.11
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.08
28 0.08
29 0.09
30 0.14
31 0.16
32 0.18
33 0.18
34 0.17
35 0.2
36 0.24
37 0.26
38 0.22
39 0.22
40 0.23
41 0.25
42 0.25
43 0.21
44 0.21
45 0.22
46 0.2
47 0.24
48 0.26
49 0.27
50 0.32
51 0.33
52 0.35
53 0.33
54 0.35
55 0.3
56 0.28
57 0.25
58 0.2
59 0.2
60 0.14
61 0.12
62 0.1
63 0.08
64 0.07
65 0.07
66 0.08
67 0.07
68 0.08
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.08
75 0.07
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.04
85 0.04
86 0.04
87 0.05
88 0.06
89 0.06
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.07
96 0.06
97 0.06
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.07
112 0.07
113 0.08
114 0.07
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.11
124 0.12
125 0.11
126 0.11
127 0.11
128 0.1
129 0.11
130 0.11
131 0.09
132 0.07
133 0.08
134 0.1
135 0.1
136 0.12
137 0.17
138 0.19
139 0.28
140 0.39
141 0.49
142 0.56
143 0.66
144 0.74
145 0.77
146 0.81
147 0.82
148 0.79
149 0.78
150 0.78
151 0.69
152 0.61
153 0.53
154 0.46
155 0.37
156 0.31
157 0.25
158 0.16
159 0.16
160 0.15
161 0.16
162 0.21
163 0.26
164 0.31
165 0.35
166 0.39
167 0.4
168 0.44
169 0.5
170 0.49
171 0.46
172 0.45
173 0.42
174 0.41
175 0.39
176 0.36
177 0.27
178 0.23
179 0.21
180 0.16
181 0.13
182 0.14
183 0.13
184 0.12
185 0.12
186 0.14
187 0.15
188 0.15
189 0.14
190 0.11
191 0.11
192 0.11
193 0.1
194 0.1
195 0.11
196 0.11
197 0.12
198 0.13
199 0.16
200 0.2
201 0.22
202 0.24
203 0.3
204 0.3
205 0.31
206 0.32
207 0.3
208 0.28
209 0.27
210 0.24
211 0.18
212 0.23
213 0.21
214 0.18
215 0.19
216 0.19
217 0.18
218 0.15