Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3EBT4

Protein Details
Accession A0A0C3EBT4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-102TPSSRQRTKLQNSRQRRRGRKRLINLVVVHydrophilic
NLS Segment(s)
PositionSequence
87-95RQRRRGRKR
Subcellular Location(s) plas 12, mito 9, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLARVSRTLYHDSVRRMPFTVRTHTVGRREGSVAESRQFGKKEKTRCRVIAQDESRGASLLVQLCSGLAKLWMTPSSRQRTKLQNSRQRRRGRKRLINLVVVLFSLGCTTIPNVNLILLLNILNDIGSLHYTPSKSARKITILIMYMTPLKWGYRRTTSRWKGGILSLDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.42
4 0.43
5 0.45
6 0.45
7 0.47
8 0.43
9 0.43
10 0.47
11 0.51
12 0.54
13 0.51
14 0.47
15 0.42
16 0.38
17 0.35
18 0.33
19 0.33
20 0.29
21 0.25
22 0.26
23 0.26
24 0.29
25 0.31
26 0.31
27 0.35
28 0.39
29 0.47
30 0.55
31 0.61
32 0.64
33 0.67
34 0.69
35 0.67
36 0.67
37 0.67
38 0.59
39 0.57
40 0.5
41 0.47
42 0.41
43 0.33
44 0.26
45 0.16
46 0.16
47 0.12
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.06
55 0.04
56 0.04
57 0.04
58 0.06
59 0.09
60 0.11
61 0.15
62 0.23
63 0.31
64 0.34
65 0.38
66 0.42
67 0.49
68 0.56
69 0.61
70 0.63
71 0.64
72 0.72
73 0.78
74 0.82
75 0.82
76 0.85
77 0.86
78 0.86
79 0.87
80 0.86
81 0.84
82 0.86
83 0.81
84 0.73
85 0.63
86 0.53
87 0.42
88 0.32
89 0.24
90 0.13
91 0.08
92 0.05
93 0.04
94 0.03
95 0.04
96 0.05
97 0.07
98 0.08
99 0.09
100 0.09
101 0.09
102 0.09
103 0.09
104 0.08
105 0.06
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.06
117 0.09
118 0.1
119 0.12
120 0.2
121 0.27
122 0.28
123 0.33
124 0.37
125 0.38
126 0.4
127 0.42
128 0.4
129 0.34
130 0.33
131 0.28
132 0.26
133 0.24
134 0.21
135 0.19
136 0.14
137 0.15
138 0.17
139 0.22
140 0.27
141 0.35
142 0.41
143 0.48
144 0.58
145 0.64
146 0.69
147 0.69
148 0.65
149 0.58
150 0.57