Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DJ53

Protein Details
Accession E9DJ53    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-60SHGPKQPSKVRKPQRKSTTTKHydrophilic
NLS Segment(s)
PositionSequence
24-56KGKGKGKSKTSNSTSSSHGPKQPSKVRKPQRKS
Subcellular Location(s) nucl 15, mito_nucl 12.499, cyto_nucl 10.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MSLFDTSSFKSRSLTETASSTNHKGKGKGKSKTSNSTSSSHGPKQPSKVRKPQRKSTTTKSRSAIVPAKNWPRCWDCQEPLSEIPPYIQRRIGFVGPKNMIVVQPHRSIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.26
4 0.28
5 0.3
6 0.32
7 0.32
8 0.33
9 0.36
10 0.36
11 0.39
12 0.43
13 0.5
14 0.56
15 0.59
16 0.63
17 0.67
18 0.71
19 0.75
20 0.73
21 0.69
22 0.64
23 0.58
24 0.53
25 0.49
26 0.48
27 0.43
28 0.42
29 0.4
30 0.4
31 0.46
32 0.51
33 0.54
34 0.56
35 0.63
36 0.69
37 0.74
38 0.78
39 0.8
40 0.81
41 0.8
42 0.79
43 0.79
44 0.8
45 0.74
46 0.73
47 0.64
48 0.57
49 0.5
50 0.49
51 0.46
52 0.38
53 0.37
54 0.38
55 0.46
56 0.46
57 0.46
58 0.45
59 0.43
60 0.44
61 0.47
62 0.47
63 0.41
64 0.41
65 0.43
66 0.42
67 0.4
68 0.38
69 0.32
70 0.24
71 0.23
72 0.26
73 0.27
74 0.25
75 0.28
76 0.26
77 0.29
78 0.33
79 0.37
80 0.36
81 0.37
82 0.43
83 0.41
84 0.41
85 0.39
86 0.35
87 0.32
88 0.3
89 0.31
90 0.28