Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9DDI8

Protein Details
Accession E9DDI8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-79LVIPCREKQGRKEKKNKKRKRLGQTFLVEHydrophilic
NLS Segment(s)
PositionSequence
58-71KQGRKEKKNKKRKR
Subcellular Location(s) nucl 14, mito 13
Family & Domain DBs
Amino Acid Sequences MKASPIRFSTIAPKTRVTAATSREQLKERKEGEKRPLYVVNHSDNPERMYLVIPCREKQGRKEKKNKKRKRLGQTFLVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.42
4 0.36
5 0.33
6 0.31
7 0.35
8 0.38
9 0.39
10 0.39
11 0.41
12 0.42
13 0.4
14 0.44
15 0.4
16 0.45
17 0.48
18 0.52
19 0.57
20 0.6
21 0.57
22 0.53
23 0.55
24 0.47
25 0.46
26 0.43
27 0.37
28 0.33
29 0.33
30 0.3
31 0.26
32 0.26
33 0.21
34 0.18
35 0.14
36 0.12
37 0.13
38 0.16
39 0.21
40 0.22
41 0.22
42 0.29
43 0.35
44 0.37
45 0.44
46 0.51
47 0.56
48 0.64
49 0.75
50 0.79
51 0.85
52 0.92
53 0.94
54 0.94
55 0.94
56 0.94
57 0.94
58 0.94
59 0.91