Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ESG4

Protein Details
Accession A0A0C3ESG4    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-22WSTRERVHKHAKKTLPHRDLBasic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019049  Nucleoporin_prot_Ndc1/Nup  
Gene Ontology GO:0031965  C:nuclear membrane  
GO:0005643  C:nuclear pore  
GO:0051028  P:mRNA transport  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF09531  Ndc1_Nup  
Amino Acid Sequences YDWSTRERVHKHAKKTLPHRDLDALIVQSLSALVCASLTEDRYGTVQWDITRSTLFLVAAEECREEVRGVYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.81
4 0.75
5 0.7
6 0.65
7 0.59
8 0.52
9 0.44
10 0.37
11 0.26
12 0.2
13 0.17
14 0.13
15 0.09
16 0.08
17 0.06
18 0.03
19 0.03
20 0.02
21 0.02
22 0.03
23 0.04
24 0.05
25 0.05
26 0.06
27 0.06
28 0.07
29 0.08
30 0.08
31 0.08
32 0.08
33 0.09
34 0.09
35 0.11
36 0.12
37 0.12
38 0.12
39 0.11
40 0.12
41 0.11
42 0.11
43 0.09
44 0.1
45 0.11
46 0.12
47 0.13
48 0.12
49 0.11
50 0.12
51 0.13
52 0.12