Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3DJW4

Protein Details
Accession A0A0C3DJW4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-70LCCRCCSSYRRTGRRRVYRHDDPYWYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, extr 6, mito 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSVCSAIGNGINAIIAAIANLLMAIVGAFTMVIVTIFDLILDILCCRCCSSYRRTGRRRVYRHDDPYWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.05
33 0.06
34 0.06
35 0.08
36 0.11
37 0.15
38 0.23
39 0.33
40 0.43
41 0.54
42 0.61
43 0.7
44 0.78
45 0.85
46 0.85
47 0.85
48 0.84
49 0.84
50 0.84