Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZQP6

Protein Details
Accession A0A0C2ZQP6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MEPGKTKQTSRKSRQKDRHHPYPDKARYAPBasic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MEPGKTKQTSRKSRQKDRHHPYPDKARYAPSEDTVPGVQKIKSSLRQARRLLAKENLAANVRVETERKVKALEADLVKAQNARQERAMAVKYHKVKFFERQKVVRKINQTKRNIKAAENTKELESTLFGLRVDLNYILHYPKTKKYISLFPPEVRNSNVLPAPIKITDDDDERSKIRELIQSKMRCGELSLEPEHDLEKPKWERTSGLPRKGIDVTDRGKDPSKQKQIEDASGDDFFGDEDNVSESSSCEWLSKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.93
4 0.92
5 0.92
6 0.92
7 0.89
8 0.87
9 0.88
10 0.85
11 0.81
12 0.74
13 0.69
14 0.63
15 0.61
16 0.55
17 0.47
18 0.42
19 0.35
20 0.35
21 0.31
22 0.28
23 0.25
24 0.24
25 0.22
26 0.2
27 0.24
28 0.28
29 0.33
30 0.4
31 0.47
32 0.53
33 0.62
34 0.64
35 0.66
36 0.68
37 0.65
38 0.61
39 0.57
40 0.52
41 0.46
42 0.45
43 0.41
44 0.34
45 0.31
46 0.26
47 0.21
48 0.19
49 0.17
50 0.16
51 0.17
52 0.21
53 0.22
54 0.23
55 0.22
56 0.22
57 0.23
58 0.25
59 0.27
60 0.23
61 0.22
62 0.23
63 0.23
64 0.22
65 0.2
66 0.17
67 0.16
68 0.17
69 0.17
70 0.17
71 0.18
72 0.18
73 0.22
74 0.24
75 0.22
76 0.23
77 0.28
78 0.33
79 0.36
80 0.38
81 0.37
82 0.38
83 0.45
84 0.52
85 0.55
86 0.55
87 0.59
88 0.65
89 0.71
90 0.74
91 0.69
92 0.69
93 0.7
94 0.72
95 0.74
96 0.73
97 0.72
98 0.71
99 0.74
100 0.66
101 0.57
102 0.55
103 0.54
104 0.51
105 0.45
106 0.41
107 0.34
108 0.32
109 0.3
110 0.22
111 0.14
112 0.11
113 0.09
114 0.08
115 0.07
116 0.08
117 0.08
118 0.07
119 0.08
120 0.06
121 0.06
122 0.06
123 0.07
124 0.08
125 0.08
126 0.11
127 0.13
128 0.17
129 0.22
130 0.22
131 0.25
132 0.28
133 0.36
134 0.39
135 0.45
136 0.44
137 0.42
138 0.47
139 0.45
140 0.43
141 0.36
142 0.33
143 0.24
144 0.24
145 0.22
146 0.17
147 0.16
148 0.15
149 0.16
150 0.14
151 0.14
152 0.12
153 0.13
154 0.14
155 0.16
156 0.17
157 0.17
158 0.19
159 0.19
160 0.21
161 0.19
162 0.19
163 0.2
164 0.24
165 0.24
166 0.28
167 0.37
168 0.37
169 0.38
170 0.4
171 0.38
172 0.31
173 0.3
174 0.27
175 0.23
176 0.24
177 0.24
178 0.23
179 0.23
180 0.23
181 0.23
182 0.21
183 0.21
184 0.17
185 0.25
186 0.28
187 0.33
188 0.35
189 0.35
190 0.36
191 0.39
192 0.5
193 0.5
194 0.54
195 0.54
196 0.52
197 0.55
198 0.54
199 0.48
200 0.4
201 0.38
202 0.33
203 0.33
204 0.34
205 0.33
206 0.36
207 0.41
208 0.45
209 0.48
210 0.55
211 0.55
212 0.56
213 0.62
214 0.63
215 0.63
216 0.58
217 0.5
218 0.43
219 0.38
220 0.35
221 0.26
222 0.2
223 0.14
224 0.11
225 0.09
226 0.06
227 0.06
228 0.08
229 0.09
230 0.09
231 0.1
232 0.09
233 0.11
234 0.13
235 0.13