Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D9X6

Protein Details
Accession E9D9X6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
160-182CAEKKGAKLKQKSFIPRHPHARPBasic
NLS Segment(s)
PositionSequence
167-171KLKQK
Subcellular Location(s) extr 16, golg 6, E.R. 2, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR006771  Bys1  
IPR037176  Osmotin/thaumatin-like_sf  
Pfam View protein in Pfam  
PF04681  Bys1  
Amino Acid Sequences MYPKTIFATFAAVASIFPVALGAGTVIIENQCADDVYLWSTAEKASEMKTFRSGEKYTEQYRLNQNGGGISIKMSLDKSMKDISQVEYTLDGQKVWYDLSNIDGYPFKDGGVSIAPSDSSCPKVYCAAGDAKCKEAYNKSDDNDATKACASTADLHVQLCAEKKGAKLKQKSFIPRHPHARPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.06
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.07
23 0.09
24 0.1
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.1
33 0.15
34 0.16
35 0.18
36 0.23
37 0.25
38 0.26
39 0.31
40 0.29
41 0.28
42 0.32
43 0.36
44 0.34
45 0.39
46 0.38
47 0.37
48 0.43
49 0.44
50 0.39
51 0.34
52 0.31
53 0.25
54 0.25
55 0.2
56 0.13
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.12
66 0.13
67 0.13
68 0.14
69 0.15
70 0.16
71 0.17
72 0.17
73 0.14
74 0.13
75 0.15
76 0.15
77 0.13
78 0.11
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.06
85 0.06
86 0.08
87 0.09
88 0.09
89 0.09
90 0.11
91 0.1
92 0.12
93 0.12
94 0.1
95 0.09
96 0.09
97 0.1
98 0.1
99 0.1
100 0.07
101 0.07
102 0.08
103 0.07
104 0.09
105 0.1
106 0.11
107 0.12
108 0.12
109 0.14
110 0.16
111 0.17
112 0.15
113 0.16
114 0.21
115 0.23
116 0.29
117 0.29
118 0.29
119 0.31
120 0.31
121 0.32
122 0.3
123 0.31
124 0.32
125 0.35
126 0.34
127 0.38
128 0.38
129 0.39
130 0.36
131 0.32
132 0.27
133 0.23
134 0.22
135 0.16
136 0.16
137 0.13
138 0.15
139 0.17
140 0.19
141 0.19
142 0.19
143 0.19
144 0.19
145 0.19
146 0.17
147 0.16
148 0.14
149 0.15
150 0.19
151 0.29
152 0.36
153 0.44
154 0.52
155 0.58
156 0.65
157 0.72
158 0.79
159 0.78
160 0.8
161 0.8
162 0.79
163 0.81