Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZWX0

Protein Details
Accession A0A0C2ZWX0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPSILRRRRRRGMHIVLGSRRBasic
NLS Segment(s)
PositionSequence
7-11RRRRR
Subcellular Location(s) mito 15, mito_nucl 14, nucl 11
Family & Domain DBs
Amino Acid Sequences MPSILRRRRRRGMHIVLGSRRERVVMARLATIYILQYHIPGTKFCRFERNRRFPPTMLATSWKKLSWAPPRRSCLSFSVTWNRTVFDHAEYEENNNNCRVQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.76
4 0.73
5 0.65
6 0.56
7 0.46
8 0.37
9 0.29
10 0.24
11 0.24
12 0.22
13 0.22
14 0.22
15 0.21
16 0.21
17 0.2
18 0.18
19 0.12
20 0.08
21 0.08
22 0.06
23 0.07
24 0.08
25 0.1
26 0.11
27 0.11
28 0.16
29 0.21
30 0.24
31 0.25
32 0.34
33 0.35
34 0.46
35 0.56
36 0.61
37 0.62
38 0.66
39 0.69
40 0.59
41 0.61
42 0.56
43 0.47
44 0.38
45 0.35
46 0.31
47 0.3
48 0.31
49 0.26
50 0.21
51 0.2
52 0.28
53 0.33
54 0.4
55 0.48
56 0.54
57 0.6
58 0.64
59 0.64
60 0.59
61 0.52
62 0.47
63 0.41
64 0.39
65 0.43
66 0.4
67 0.43
68 0.41
69 0.37
70 0.33
71 0.33
72 0.28
73 0.21
74 0.21
75 0.18
76 0.21
77 0.21
78 0.25
79 0.29
80 0.29
81 0.29
82 0.29