Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ERY6

Protein Details
Accession A0A0C3ERY6    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
26-51AHRFTTARWRKRSRTPHFRTQKIPLRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, mito 5, cysk 4, mito_nucl 4, nucl 3, extr 3, pero 3
Family & Domain DBs
Amino Acid Sequences MCTLTAEALHLIFDANHIRDVGNAAAHRFTTARWRKRSRTPHFRTQKIPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.12
5 0.12
6 0.12
7 0.14
8 0.12
9 0.11
10 0.1
11 0.1
12 0.1
13 0.1
14 0.11
15 0.09
16 0.09
17 0.17
18 0.27
19 0.35
20 0.44
21 0.52
22 0.58
23 0.68
24 0.79
25 0.79
26 0.81
27 0.8
28 0.82
29 0.84
30 0.85
31 0.82