Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CTX5

Protein Details
Accession E9CTX5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-40NQQLHCERKSKPTPRKLCKQEKAENYKMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018860  APC_suCDC26  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
Pfam View protein in Pfam  
PF10471  ANAPC_CDC26  
Amino Acid Sequences MKPLGQRFGLPCNQQLHCERKSKPTPRKLCKQEKAENYKMIRRKPTVITVTSEDILAFEEARLRQQEQQQEQQNVAKNSENKSGAVDPNDELKPLPGDKARIIRSRDERIGVSRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.46
4 0.46
5 0.5
6 0.48
7 0.52
8 0.61
9 0.66
10 0.7
11 0.74
12 0.79
13 0.8
14 0.88
15 0.89
16 0.89
17 0.88
18 0.87
19 0.85
20 0.84
21 0.85
22 0.8
23 0.77
24 0.69
25 0.68
26 0.64
27 0.61
28 0.58
29 0.52
30 0.5
31 0.46
32 0.5
33 0.47
34 0.42
35 0.4
36 0.35
37 0.34
38 0.3
39 0.26
40 0.18
41 0.13
42 0.12
43 0.09
44 0.06
45 0.04
46 0.06
47 0.07
48 0.08
49 0.1
50 0.1
51 0.14
52 0.19
53 0.27
54 0.29
55 0.37
56 0.42
57 0.42
58 0.42
59 0.42
60 0.43
61 0.37
62 0.34
63 0.31
64 0.28
65 0.3
66 0.35
67 0.32
68 0.27
69 0.29
70 0.3
71 0.29
72 0.27
73 0.26
74 0.2
75 0.24
76 0.24
77 0.21
78 0.18
79 0.17
80 0.18
81 0.17
82 0.21
83 0.18
84 0.21
85 0.26
86 0.34
87 0.4
88 0.43
89 0.46
90 0.51
91 0.56
92 0.61
93 0.61
94 0.56
95 0.52
96 0.53