Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2YUK4

Protein Details
Accession A0A0C2YUK4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-63RELLRECRTKQKRTRPCPCHCESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MLPATILRVGTDNRYKSSDQGTGLSNLGFVKSLGLDESLLRELLRECRTKQKRTRPCPCHCESSVITRSALPSPSPVRGYHVSIHLSLTRCAQSCTPRGVRVHGCQDLKALH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.36
4 0.4
5 0.36
6 0.3
7 0.3
8 0.29
9 0.27
10 0.26
11 0.23
12 0.18
13 0.14
14 0.12
15 0.1
16 0.08
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.09
30 0.15
31 0.19
32 0.2
33 0.21
34 0.32
35 0.4
36 0.48
37 0.56
38 0.61
39 0.67
40 0.75
41 0.84
42 0.82
43 0.83
44 0.82
45 0.76
46 0.72
47 0.62
48 0.58
49 0.48
50 0.47
51 0.43
52 0.36
53 0.33
54 0.26
55 0.27
56 0.23
57 0.23
58 0.15
59 0.15
60 0.17
61 0.2
62 0.21
63 0.2
64 0.24
65 0.25
66 0.28
67 0.26
68 0.28
69 0.26
70 0.25
71 0.27
72 0.25
73 0.24
74 0.22
75 0.23
76 0.23
77 0.21
78 0.23
79 0.25
80 0.28
81 0.3
82 0.38
83 0.39
84 0.41
85 0.42
86 0.47
87 0.5
88 0.51
89 0.56
90 0.55
91 0.52
92 0.47