Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2ZEY0

Protein Details
Accession A0A0C2ZEY0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-88SKKWYRNCKRGGKECQQPKRTRKRRKVKANVVGEEKGBasic
NLS Segment(s)
PositionSequence
60-79KRGGKECQQPKRTRKRRKVK
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MARRILSHGTTYYFAKGIKIPPYQVPTGLSDQPVHSIETVLAALERGARAASKKWYRNCKRGGKECQQPKRTRKRRKVKANVVGEEKGESAKIVIERC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.21
4 0.23
5 0.27
6 0.29
7 0.29
8 0.33
9 0.37
10 0.36
11 0.34
12 0.31
13 0.28
14 0.29
15 0.28
16 0.24
17 0.21
18 0.2
19 0.22
20 0.21
21 0.18
22 0.14
23 0.12
24 0.1
25 0.1
26 0.1
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.06
37 0.08
38 0.16
39 0.23
40 0.3
41 0.37
42 0.48
43 0.55
44 0.62
45 0.7
46 0.72
47 0.74
48 0.77
49 0.79
50 0.77
51 0.79
52 0.81
53 0.82
54 0.81
55 0.81
56 0.82
57 0.85
58 0.87
59 0.88
60 0.89
61 0.9
62 0.92
63 0.94
64 0.95
65 0.94
66 0.93
67 0.92
68 0.88
69 0.82
70 0.73
71 0.62
72 0.52
73 0.42
74 0.32
75 0.23
76 0.16
77 0.11
78 0.13