Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2ZNQ6

Protein Details
Accession A0A0C2ZNQ6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKHRRSCKRGKRHLAEALPKAKEBasic
NLS Segment(s)
PositionSequence
4-34RRSCKRGKRHLAEALPKAKELYHRKKARLAR
Subcellular Location(s) nucl 14.5, mito_nucl 13.833, mito 11, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MKHRRSCKRGKRHLAEALPKAKELYHRKKARLARKDDLEEIGDSLPMHFRDMLPELPMPLPPTAMSSLTLGNKEPSIAPLSVIESNDPSVQFQPVEQPWEVQSCRSALPVPPRALFKLQSNSFGLFHVYDVRMLPYHNPVLNEPTGEHVKVDKPDGTSNPFHPYPNESSMHLGEWYWNQCSLQNKSGFKRLLSIVGSPDFDPEDIRNMKWTTVDCELGELENKTTVEWLNECDGWKKTSISINAPFHQCFLPLTLSTSGPSTILGQGFLSSVLGFGHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.83
4 0.8
5 0.7
6 0.62
7 0.54
8 0.46
9 0.46
10 0.48
11 0.5
12 0.52
13 0.59
14 0.63
15 0.71
16 0.78
17 0.8
18 0.79
19 0.77
20 0.75
21 0.76
22 0.76
23 0.7
24 0.64
25 0.55
26 0.45
27 0.38
28 0.29
29 0.21
30 0.16
31 0.14
32 0.15
33 0.13
34 0.14
35 0.13
36 0.13
37 0.16
38 0.19
39 0.19
40 0.18
41 0.18
42 0.19
43 0.19
44 0.2
45 0.18
46 0.15
47 0.14
48 0.12
49 0.14
50 0.14
51 0.14
52 0.14
53 0.13
54 0.16
55 0.17
56 0.18
57 0.16
58 0.16
59 0.15
60 0.15
61 0.14
62 0.12
63 0.14
64 0.13
65 0.12
66 0.12
67 0.15
68 0.16
69 0.16
70 0.14
71 0.12
72 0.13
73 0.14
74 0.13
75 0.12
76 0.11
77 0.12
78 0.11
79 0.11
80 0.15
81 0.15
82 0.19
83 0.17
84 0.17
85 0.17
86 0.22
87 0.22
88 0.17
89 0.17
90 0.14
91 0.15
92 0.15
93 0.15
94 0.14
95 0.22
96 0.28
97 0.29
98 0.29
99 0.31
100 0.32
101 0.33
102 0.31
103 0.28
104 0.3
105 0.28
106 0.3
107 0.3
108 0.29
109 0.27
110 0.25
111 0.21
112 0.13
113 0.12
114 0.12
115 0.1
116 0.09
117 0.09
118 0.1
119 0.09
120 0.09
121 0.1
122 0.11
123 0.13
124 0.14
125 0.14
126 0.14
127 0.17
128 0.17
129 0.16
130 0.13
131 0.14
132 0.14
133 0.13
134 0.13
135 0.11
136 0.13
137 0.14
138 0.16
139 0.14
140 0.15
141 0.18
142 0.19
143 0.23
144 0.22
145 0.23
146 0.27
147 0.26
148 0.24
149 0.23
150 0.25
151 0.25
152 0.27
153 0.27
154 0.22
155 0.24
156 0.24
157 0.24
158 0.19
159 0.15
160 0.12
161 0.14
162 0.15
163 0.13
164 0.13
165 0.13
166 0.15
167 0.21
168 0.25
169 0.28
170 0.33
171 0.36
172 0.38
173 0.46
174 0.45
175 0.39
176 0.38
177 0.32
178 0.31
179 0.28
180 0.26
181 0.21
182 0.22
183 0.23
184 0.19
185 0.19
186 0.15
187 0.13
188 0.13
189 0.11
190 0.17
191 0.17
192 0.17
193 0.21
194 0.22
195 0.22
196 0.23
197 0.24
198 0.21
199 0.23
200 0.25
201 0.2
202 0.2
203 0.2
204 0.19
205 0.2
206 0.16
207 0.13
208 0.14
209 0.14
210 0.13
211 0.14
212 0.13
213 0.14
214 0.14
215 0.16
216 0.16
217 0.18
218 0.19
219 0.22
220 0.23
221 0.23
222 0.24
223 0.22
224 0.23
225 0.28
226 0.31
227 0.34
228 0.41
229 0.46
230 0.49
231 0.52
232 0.49
233 0.44
234 0.4
235 0.34
236 0.26
237 0.22
238 0.21
239 0.17
240 0.2
241 0.2
242 0.2
243 0.2
244 0.21
245 0.18
246 0.15
247 0.15
248 0.13
249 0.15
250 0.15
251 0.15
252 0.13
253 0.13
254 0.13
255 0.13
256 0.11
257 0.07
258 0.07