Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Z4K5

Protein Details
Accession A0A0C2Z4K5    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
56-77PEWTDRRTSVRQRRGKRRVALTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_mito 10.333, cyto_pero 7.833, mito 6.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MSAYQHDNGRLAGHTLNAWLARWIYLPLEVYATGREGDEPIECNVLVIKVGRMVTPEWTDRRTSVRQRRGKRRVALTVVLIDVTGDSCRCCTDISANSAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.13
5 0.12
6 0.12
7 0.11
8 0.11
9 0.11
10 0.11
11 0.1
12 0.11
13 0.12
14 0.11
15 0.11
16 0.11
17 0.11
18 0.11
19 0.11
20 0.09
21 0.08
22 0.08
23 0.07
24 0.07
25 0.08
26 0.09
27 0.08
28 0.09
29 0.09
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.05
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.11
42 0.13
43 0.16
44 0.16
45 0.18
46 0.19
47 0.19
48 0.24
49 0.29
50 0.37
51 0.44
52 0.53
53 0.6
54 0.69
55 0.79
56 0.83
57 0.85
58 0.82
59 0.8
60 0.77
61 0.73
62 0.66
63 0.57
64 0.49
65 0.41
66 0.33
67 0.25
68 0.16
69 0.11
70 0.09
71 0.08
72 0.06
73 0.07
74 0.07
75 0.09
76 0.1
77 0.1
78 0.12
79 0.19
80 0.24