Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9D888

Protein Details
Accession E9D888    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-42IRDRHKSKGKRILSRIKRALBasic
NLS Segment(s)
PositionSequence
26-38RHKSKGKRILSRI
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDTPHEALLPPDRPSLSQQTNGIRDRHKSKGKRILSRIKRALCAFFCYRKHSHSDYSSKEKLQEDREPGKFDPTLRSIPNRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.34
4 0.35
5 0.37
6 0.41
7 0.47
8 0.49
9 0.48
10 0.42
11 0.45
12 0.46
13 0.5
14 0.52
15 0.52
16 0.58
17 0.65
18 0.7
19 0.73
20 0.75
21 0.77
22 0.77
23 0.8
24 0.78
25 0.7
26 0.66
27 0.58
28 0.54
29 0.44
30 0.4
31 0.34
32 0.33
33 0.33
34 0.34
35 0.35
36 0.33
37 0.38
38 0.37
39 0.39
40 0.4
41 0.45
42 0.46
43 0.52
44 0.53
45 0.49
46 0.5
47 0.47
48 0.46
49 0.45
50 0.46
51 0.46
52 0.5
53 0.53
54 0.53
55 0.5
56 0.5
57 0.45
58 0.4
59 0.39
60 0.35
61 0.37
62 0.37
63 0.43